CAZyme Information: MGYG000002379_00588

Basic Information

• Species: Lactobacillus acidophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus acidophilus
• CAZyme ID: MGYG000002379_00588
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000002379_4|CGC1	26471.86	10.0805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002379	2009479	Isolate	not provided	not provided

• Gene Location: Start: 28872; End: 29573 Strand: -

Full Sequence      

MTFFKVKSFKNCTALQVPTPKVAKWLKKNHFKQKLFIVSNGISEKFIQNPHKEKVGHPFT
ILCIGRFSHEKRQETLFKAMQLSKHTSEIRLIFAGQGPLEKEYAKLAKQLPKKPIMRYFA
PADLKEIMFQTDLVVHCADVEIEGMACMEAFSSGCVSVIADSSLSSTVSYALSENNRFSA
GDSRALAQKIDYWFEHPSELIKMRQEYRSYGKTLNVARSAKIALGNLENLTLK

Enzyme Prediction     

No EC number prediction in MGYG000002379_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	56	200	3.7e-18	0.925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	1.34e-26	1	220	136	365	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	1.57e-21	17	208	146	345	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.18e-20	3	210	142	356	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.01e-16	58	212	2	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	1.29e-16	1	161	125	295	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGK94198.1	4.31e-166	1	233	1	233
ASX14955.1	4.31e-166	1	233	1	233
ACS07494.1	6.92e-166	1	233	14	246
AAV42864.1	6.92e-166	1	233	14	246
ASN46898.1	1.66e-164	1	233	102	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	1.43e-31	58	207	2	151	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002379_00588.