CAZyme Information: MGYG000002379_01693

Basic Information

• Species: Lactobacillus acidophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus acidophilus
• CAZyme ID: MGYG000002379_01693
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174		19221.19	11.1906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002379	2009479	Isolate	not provided	not provided

• Gene Location: Start: 45; End: 569 Strand: +

Full Sequence      

MGKNPTANAIIAFMSQVKAAGYKPLLYASSSVLRNNINTNAVVAKFPNSLWVASYAVSGR
IDNPNFSYFPSMKGVSIWQFTDNWRGLNVDGNINVLPLSTSNSAVSQAPKKSSAKARVLK
HAAHVYDKHGKRKKNRKTLKKNTTVTTHGKKKTINGKKYYRIGKNAYIKAANLY

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	5	85	5.2e-18	0.4180790960451977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06415	GH25_Cpl1-like	5.14e-43	3	96	103	196	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
smart00641	Glyco_25	1.13e-20	3	102	17	109	Glycosyl hydrolases family 25.
pfam03217	SLAP	4.92e-18	118	171	1	54	SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.
pfam01183	Glyco_hydro_25	7.03e-11	3	83	101	174	Glycosyl hydrolases family 25.
cd06414	GH25_LytC-like	9.35e-11	1	93	106	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN45893.1	1.33e-119	1	174	150	323
QKQ21552.1	1.33e-119	1	174	150	323
AGK95054.1	1.33e-119	1	174	150	323
AZN77453.1	1.33e-119	1	174	150	323
AVW87613.1	1.33e-119	1	174	150	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H09_A	1.50e-15	8	83	105	178	ChainA, LYSOZYME [Streptococcus phage Cp1]
1OBA_A	1.50e-15	8	83	106	179	ChainA, Lysozyme [Streptococcus phage Cp1]
2IXU_A	1.50e-15	8	83	106	179	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXV_A	1.50e-15	8	83	106	179	ChainA, LYSOZYME [Streptococcus phage Cp1],2J8F_A Chain A, LYSOZYME [Streptococcus phage Cp1],2J8G_A Chain A, LYSOZYME [Streptococcus phage Cp1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8HA43	6.75e-18	3	110	250	357	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2
P15057	8.24e-15	8	83	106	179	Lysozyme OS=Streptococcus phage Cp-1 OX=10747 GN=CPL1 PE=1 SV=2
P19386	7.58e-14	8	83	106	179	Lysozyme OS=Streptococcus phage Cp-9 OX=10749 GN=CPL9 PE=3 SV=1
P19385	1.31e-12	9	83	107	179	Lysozyme OS=Streptococcus phage Cp-7 OX=10748 GN=CPL7 PE=1 SV=2
P33486	3.44e-11	3	74	110	181	Lysozyme OS=Lactococcus phage mv1 OX=33769 GN=lysA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999612	0.000383	0.000020	0.000001	0.000001	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002379_01693.