CAZyme Information: MGYG000002380_02011

Basic Information

• Species: Levilactobacillus brevis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Levilactobacillus; Levilactobacillus brevis
• CAZyme ID: MGYG000002380_02011
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41454.01	10.9641

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002380	2621559	Isolate	Russia	Europe

• Gene Location: Start: 18381; End: 19505 Strand: -

Full Sequence      

MQRKGIWGSLTLIVLVSGLAWGLTNLHTSQAQASRAVTTYKQWQKAYVAGKSQKYVKANN
GQGATTAFSEGQGYGMLAAVLAAKKGANTRTTFNQLYKYYRAHRISSSLPLMQWKQTKRA
GKMTSVGSEKNSATDGDLDIAYALILADKKWGSKQVNYKQAAKKLLAAIKAKEINPTTAL
PTMGNWATSSYDRSKLRTSDLLTGYFKTFAKYTKDKRWTTVAKRSQIAVKKLSARHKTGL
FPDFIYATGSGIKLKAVKPYAIESGTDNQYGYNACRVPWRLAQTYRMSKDAVTKRALTKQ
LTFFNKKKKVTAVYTLGGKAVNQYVNTAFTAPVNFGARTLKKTALKTKTAKQLPKSIEKK
NYYSATIQVLTALQ

Enzyme Prediction     

No EC number prediction in MGYG000002380_02011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	39	373	1.1e-77	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	9.55e-23	40	373	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	2.83e-14	29	363	18	332	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	2.73e-13	19	371	4	345	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX67886.1	3.21e-266	1	374	1	374
QOP53288.1	2.84e-265	1	374	3	376
QCZ56346.1	7.55e-265	1	374	1	374
ARQ92614.1	8.14e-265	1	374	3	376
QCZ46728.1	8.14e-265	1	374	3	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	7.83e-49	27	339	52	366	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.43e-28	27	332	21	335	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.65e-28	27	332	27	341	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1CEM_A	1.62e-22	69	373	62	350	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]
1KWF_A	1.05e-21	69	373	62	350	ChainA, Endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.12e-48	28	339	54	366	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	4.52e-29	27	373	77	431	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	5.78e-21	69	373	94	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	8.47e-15	26	285	52	291	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P37699	6.55e-14	40	285	67	291	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.146691	0.810436	0.040368	0.001408	0.000516	0.000541

TMHMM  Annotations     

start	end
5	24