CAZyme Information: MGYG000002382_01845

Basic Information

• Species: Stenotrophomonas maltophilia_AK
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AK
• CAZyme ID: MGYG000002382_01845
• CAZy Family: GT2
• CAZyme Description: Ubiquinone biosynthesis O-methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1137	MGYG000002382_62|CGC2	126040.22	5.2169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002382	4489830	Isolate	not provided	not provided

• Gene Location: Start: 54631; End: 58044 Strand: -

Full Sequence      

MIEFTGERFVPTEQGVIRQEHLHRYAWCLPLVEGKDVLDVASGEGYGSAMLASRARSVCG
VDISHEAVDHAAGRYSAQTNLKYLQGSAAAIPLADDSVDVVVSFETIEHLMEQEEMMAEI
RRVLRPDGVLVMSSPNKEVYSDRAGYHNDFHVKELYQAEFQALVGRYFPASRLCGHRMAV
CSTITPISEAERTDSYQALTDTGSGVEARVASVPDAVYFVVVAAADASLLPDTPASVLYA
ESEDLYAQQHDIARWAQGLDNEREDTIRWARSLEAELEKSRADYHRLEVEFEDRTRWALE
LDQVVQAGGGLTGAAELRARNDALQAQLEQVRGEKADVEADLQRHQAASQHEAAELRRLL
QTAHETVASRSEVSRELQRRSGLAFRPGAEGTSELEVKRVIHEYDEQLESLNDAFAKVLA
SKSWRITRPMRFASRLLRGDVPAIIASLRASGLARHPLLAPLARPVRNWLLRRDNARVEP
LSGLALQSVVEDSGEVLKTLSFPIHESPEVSIVIPTYGNLPHTLACLRSIAAHPPAVSYE
VLVLEDASGDAEIEKLVPVPGLRFHHNPQNLGFLLSCNQALELARGRYTYFLNNDTEVRP
GWMDEMLDVFQRMPDCGMVGSKLVYPDGRLQEAGGIIWRDGSAWNYGRLDNPADSQYNYL
RPVDYCSGASLLIPSALLRELGGFDPEFVPAYCEDSDLAFRVRKAGYQLYYCPTSEVVHY
EGISHGTDTGSGIKAYQVANQKKLRERWQDELALHEPNGEHVVLARDRAWQKETVLIVDH
YVPQPDRDAGSRTMIAFIDALLARGCVVKFWADNLYFDPIYTPPLQARGVEVMYGGQWVG
GFARYLDENPHVRTVMLSRPHIAEHYLDALCKHPGVRSVYYGHDLHFRRMEMEATRNGGS
DGEARSMELLERRIWKAVDRVLYPSAEEAQDVRALEPDVDARAILPYAFDHFNDEAVPAQ
RAGILFVAGFAHGPNVDAARWLVESVMPQVWARHPGVKLSLVGSNPTDAVRALAGEHVEV
TGFVSDEELARRYGVARVAIVPLRFGAGVKGKVVEAMQQGLPLVTTGIGAQGLVGLEAVV
TVADEADGLAAGLLSLLEDDALWLQRSRAAASYCRSQFSRDALGRALESAFALEKKA

Enzyme Prediction     

No EC number prediction in MGYG000002382_01845.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	508	748	5.9e-18	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	4.41e-45	508	724	3	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.84e-44	512	721	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam08241	Methyltransf_11	1.16e-24	38	132	1	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam13649	Methyltransf_25	2.47e-23	37	128	1	97	Methyltransferase domain. This family appears to be a methyltransferase domain.
pfam13692	Glyco_trans_1_4	4.47e-20	964	1070	4	107	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN82706.1	0.0	1	1137	1	1137
AWH27953.1	0.0	1	1137	1	1165
ALA85197.1	0.0	1	1132	1	1134
ALA89153.1	0.0	1	1132	1	1134
AOX62844.1	0.0	1	1130	1	1181

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XXL_A	2.01e-07	37	162	25	159	Thecrystal structure of YcgJ protein from Bacillus subitilis at 2.1 A resolution [Bacillus subtilis],1XXL_B The crystal structure of YcgJ protein from Bacillus subitilis at 2.1 A resolution [Bacillus subtilis],2GLU_A The crystal structure of YcgJ protein from Bacillus subitilis [Bacillus subtilis],2GLU_B The crystal structure of YcgJ protein from Bacillus subitilis [Bacillus subtilis]
4N9W_A	3.75e-06	955	1102	186	336	Crystalstructure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_A Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_B Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_C Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155],4NC9_D Crystal structure of phosphatidyl mannosyltransferase PimA [Mycolicibacterium smegmatis MC2 155]
2GEJ_A	3.91e-06	955	1102	202	352	CrystalStructure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP-Man [Mycolicibacterium smegmatis MC2 155],2GEK_A Crystal Structure of phosphatidylinositol mannosyltransferase (PimA) from Mycobacterium smegmatis in complex with GDP [Mycolicibacterium smegmatis MC2 155]
3L8D_A	5.27e-06	36	128	56	147	Crystalstructure of methyltransferase from Bacillus Thuringiensis [Bacillus thuringiensis str. Al Hakam]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0QUV5	1.11e-23	2	164	12	174	Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_2350 PE=1 SV=1
P9WJZ0	3.35e-22	1	175	27	202	Probable S-adenosylmethionine-dependent methyltransferase MT3114 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3114 PE=3 SV=1
P9WJZ1	3.35e-22	1	175	27	202	Probable S-adenosylmethionine-dependent methyltransferase Rv3030 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3030 PE=1 SV=1
P55465	6.72e-22	502	749	619	875	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.36e-14	502	728	568	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002382_01845.