CAZyme Information: MGYG000002382_02523

Basic Information

• Species: Stenotrophomonas maltophilia_AK
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AK
• CAZyme ID: MGYG000002382_02523
• CAZy Family: AA10
• CAZyme Description: Chitin-binding protein CbpD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000002382_96|CGC1	42214.27	7.3892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002382	4489830	Isolate	not provided	not provided

• Gene Location: Start: 15376; End: 16545 Strand: +

Full Sequence      

MHLSHRAVLALSVVAGLALSGSAFAHGTMTKPLSRVKQCHEGNPENPTNPACAAAKAIGG
SQPFYDWSAIAHGNANGNHRELVRDGELCSASIPKYRGLDLNRTDWPTTPIRADARGRYT
FEFRAPAPHATREWKFYVTRDGWQPGSPLRWADLQEFCTLGNTPLSEGGVYKLDCPLPKR
SGQHIIYNTWQRSDSQEAFYTCMDVRFEGGDGVVPPPQWQDAGAVTANGALDVDSTVTLR
VFNANGNDLERVETTLAAGQTAPAQWPLALARKVNASAQHARVGVMKNGVITPVASATEN
RVYLKPGNRFQLETQVPGPVDPVNPPGGDFDFVYPAGLGSYTPGETVVKGTDGKLYACRP
FPEGAWCNINADAYRPGTGYAWRDAWVAY

Enzyme Prediction     

No EC number prediction in MGYG000002382_02523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	26	205	9.6e-47	0.9887640449438202
CBM73	340	386	5.1e-18	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21177	LPMO_AA10	1.61e-70	26	205	1	179	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
PRK13211	PRK13211	1.67e-64	14	386	12	474	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	2.94e-64	8	307	12	305	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	6.89e-62	26	205	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
pfam18416	GbpA_2	1.25e-27	219	315	1	102	N-acetylglucosamine binding protein domain 2. This domain can be found in N-acetylglucosamine binding protein (GbpA) from Vibrio cholerae, a bacterial pathogen that colonizes the chitinous exoskeleton of zooplankton as well as the human gastrointestinal tract. GbpA binds to GlcNAc oligosaccharides. Structural comparison show that there are distant structural similarities between domain 2 of GbpA and the beta-domain of the flagellin protein p5. It is suggested that this domain interacts with the bacterial surface, and functions to project an alginate binding domain of the protein from the cell surface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI09498.1	6.48e-290	1	389	1	391
AEM53237.1	6.48e-290	1	389	1	391
ARZ76341.1	5.32e-289	1	389	1	391
QQQ42319.1	7.56e-289	1	389	1	391
AWT16664.1	7.56e-289	1	389	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IF7_A	2.31e-56	26	207	1	182	CrystalStructure of AA10 Lytic Polysaccharide Monooxygenase from Tectaria macrodonta [Tectaria macrodonta]
5FJQ_A	1.65e-39	26	207	1	179	Structuraland functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_B Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_C Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus]
4OY7_A	2.70e-30	26	210	1	196	Structureof cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_B Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_C Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_D Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_E Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_F Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_G Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_H Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)]
2XWX_A	8.18e-30	84	308	55	277	Vibriocholerae colonization factor GbpA crystal structure [Vibrio cholerae],2XWX_B Vibrio cholerae colonization factor GbpA crystal structure [Vibrio cholerae]
5OPF_A	8.53e-22	26	207	1	193	Structureof LPMO10B from from Micromonospora aurantiaca [Micromonospora aurantiaca ATCC 27029]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02I11	6.01e-116	11	387	11	387	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=cpbD PE=1 SV=1
Q9I589	8.51e-116	11	387	11	387	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cbpD PE=1 SV=1
Q9KLD5	4.67e-35	84	386	78	482	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1
A5F0H4	6.43e-35	84	386	78	482	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=gbpA PE=3 SV=1
C3LW75	6.43e-35	84	386	78	482	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000419	0.998695	0.000194	0.000313	0.000194	0.000160

TMHMM  Annotations     

start	end
7	29