CAZyme Information: MGYG000002382_03138

Basic Information

• Species: Stenotrophomonas maltophilia_AK
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AK
• CAZyme ID: MGYG000002382_03138
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	MGYG000002382_119|CGC2	50070.22	7.8449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002382	4489830	Isolate	not provided	not provided

• Gene Location: Start: 50728; End: 52083 Strand: +

Full Sequence      

MKRREFIAASAAVAASSLLPQTPAWARGRKVRLAMIGTGMRGLVLLKELVRRDDVEVVAL
CDIEPIMLGRAMEMVAKAGKPAPKTYGQDRDTNAWKRLLEQKGIDGVIIATPWEYHAPMA
IAAMQAGVAVGCEVVAGITLQDHWDVLKTQLSTGTPYMLLENVCYRRDVMAALQMVRQGL
FGELVHLQAGYQHDLRGVKFNSGDPNQPYDSGVEFGPKGWSEARWRTEHSVERNGELYPS
HGIGPCAMYTGINRGNRFTHINAFATKARGLHEYTVAKSGGTTHPSTQVKFKLGDIVTTT
LACENGETILLQHDTSLPRPYSMGFRVQGTKGLWMDVNHSIHIEGRSPPHQWEEFKKYQD
EYEHPLWKQNADTAASAGHGGMDWFVIHAFVEALKAKAPMPIDIYDAVTWSAITPLSEQS
IANGFQTLEFPDFTAGAWKTRKPIFAFDGKY

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	29	441	3.4e-171	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.70e-20	28	424	1	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.09e-10	31	133	1	92	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
smart00859	Semialdhyde_dh	0.003	32	130	1	95	Semialdehyde dehydrogenase, NAD binding domain. The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase, an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGL86364.1	0.0	1	451	1	451
QCZ99178.1	0.0	1	451	1	451
QCB34209.1	0.0	1	451	1	451
CCH14504.1	0.0	1	451	1	451
VEF35159.1	0.0	1	451	1	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.09e-156	29	451	19	444	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	7.58e-77	30	444	42	444	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3E18_A	1.82e-09	29	203	4	171	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
6A3F_A	6.55e-08	82	237	72	207	Levoglucosandehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3F_B Levoglucosan dehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_A Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_B Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_C Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_D Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_A Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_B Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_C Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_D Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_A Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_B Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_C Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_D Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3]
3EC7_A	5.45e-07	27	154	20	138	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	0.0	1	451	4	454	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	5.98e-156	29	451	19	444	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	5.26e-145	23	446	45	467	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	6.44e-143	30	446	49	465	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A8H2K3	1.96e-94	31	444	53	451	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	1.000004	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002382_03138.