CAZyme Information: MGYG000002384_00871

Basic Information

• Species: Lactobacillus helveticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus helveticus
• CAZyme ID: MGYG000002384_00871
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase LacZ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002384_1|CGC5	41217.66	7.0967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002384	2058319	Isolate	Russia	Europe

• Gene Location: Start: 804491; End: 805564 Strand: -

Full Sequence      

MLEPEEGKYDFSELDKVVKKLSDANFDIVIGTSTAAMPAWMFKKYPDVARVDYQGRRHVF
GQRYNFCPNSKNYQRLAGNLVEELAKHYQNNPNIVVWHVNNEYGGNCYCENCQHEFRKWL
KDKYQTLDALNKAWNMNVWSHTIYDWDEIVVPNELGDAWGPEGSETIVAGLSIDYLRFQS
ESLQNLFKMEKQIIKKHDSETPVTTNFHSLPNKMVDYQKWAKDQDIISYDSYPTYDAPIY
KPAFLYDLMRSLKHQPFMLMESAPSQVNWQPYSPLKRPGQMAATELQAVVAHGVDTVQFF
QLKQAVGGSEKFHSAVIAHSQRTDTRVFKELVDLGHKLKRAGSTILGSTINELRPKN

Enzyme Prediction     

No EC number prediction in MGYG000002384_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	2	339	2.9e-130	0.8975741239892183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	3.48e-170	1	340	36	375	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	4.72e-96	2	340	57	390	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam01301	Glyco_hydro_35	5.14e-04	3	124	51	167	Glycosyl hydrolases family 35.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX27481.1	5.56e-272	1	357	1	357
BCD38166.1	2.17e-269	1	357	1	357
AGQ23893.1	2.17e-269	1	357	1	357
AYE61187.1	1.47e-267	1	357	1	357
AAU11511.1	1.38e-245	37	357	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TTS_A	3.39e-125	2	346	50	391	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
4OIF_A	7.07e-84	2	345	58	405	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	7.22e-84	2	345	59	406	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5E9A_A	3.33e-83	2	350	82	426	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
5DFA_A	5.39e-83	2	345	58	405	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5FJ41	9.65e-225	1	348	47	393	Beta-galactosidase LacZ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=lacZ PE=1 SV=1
C6H178	1.40e-219	1	348	47	393	Beta-galactosidase LacA OS=Lactobacillus acidophilus OX=1579 GN=lacA PE=1 SV=1
Q09HN2	5.88e-117	3	351	52	397	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1
Q9KI47	7.49e-115	3	351	52	398	Beta-galactosidase BgaA OS=Planococcus sp. (strain 'SOS Orange') OX=128803 GN=bgaA PE=1 SV=1
D5JGG0	8.58e-93	2	339	49	380	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002384_00871.