CAZyme Information: MGYG000002384_02065

Basic Information

• Species: Lactobacillus helveticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus helveticus
• CAZyme ID: MGYG000002384_02065
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000002384_1|CGC12	24875.64	10.1876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002384	2058319	Isolate	Russia	Europe

• Gene Location: Start: 1865341; End: 1865988 Strand: +

Full Sequence      

MAKKRKSRIPKSVKTVVRVFIILFILLVAYVGFHYYRRYAIQSEQIRQAQLEREQEAAKL
LREKKAFIKKIGPIAREVDKSYGLLPSITVAQACLESNYGQSDLSQKYNNLFGVKGTNPN
TSAVMTTKEYVKGKWITVKARFQIYDSYEASIRAHARLFQNGTTWNHQQYKHVLASKDYK
TQAKALVTDSYATDPDYADKLINLIEQFDLEKYDK

Enzyme Prediction     

No EC number prediction in MGYG000002384_02065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	72	210	9.6e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.74e-62	63	215	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.13e-33	65	215	321	473	amidase domain-containing protein.
smart00047	LYZ2	2.72e-33	65	214	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	1.37e-27	65	214	151	303	1,4-beta-N-acetylmuramoylhydrolase.
pfam01832	Glucosaminidase	1.46e-26	72	210	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJY61974.1	1.45e-146	1	215	1	215
AQY53021.1	1.45e-146	1	215	1	215
QYH34032.1	1.45e-146	1	215	1	215
AKG66327.1	1.45e-146	1	215	1	215
AUI74845.1	1.45e-146	1	215	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.07e-26	67	214	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.80e-17	67	214	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.92e-14	66	205	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.31e-14	66	205	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.68e-13	66	205	4	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.59e-40	63	215	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	1.50e-24	66	214	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	1.39e-23	66	214	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.91e-23	67	214	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	5.85e-22	66	214	64	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996916	0.000149	0.000068	0.000001	0.000000	0.002876

TMHMM  Annotations     

start	end
15	37