CAZyme Information: MGYG000002385_03022

Basic Information

• Species: Leminorella richardii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella richardii
• CAZyme ID: MGYG000002385_03022
• CAZy Family: GH25
• CAZyme Description: Lysozyme M1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002385_1|CGC20	27931.86	6.129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002385	3976274	Isolate	not provided	not provided

• Gene Location: Start: 3234657; End: 3235382 Strand: -

Full Sequence      

MRIKHLLGTVCVVAVFAACFVYALYQGIVRLNYPSRDDFPIQGIDISHHQKEIDWDRLKV
SEIQFIFIKATEGGDFKDKRFQLNWRDARDRGFAVGAYHFFTFCSSGADQADNFISSVPL
EKGTLPPVIDLEYGGNCQLTSGKQEVLREVEILASRLEKAYGRKPILYVTKEFYNDFLID
QMRENAIWIRDIFGKPTLAEPDRDWLFWQYANRGKLEGIETFVDFNVFNGKKDKFETLIN
N

Enzyme Prediction     

No EC number prediction in MGYG000002385_03022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	44	219	9.5e-50	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06413	GH25_muramidase_1	2.03e-105	39	230	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	3.15e-60	43	230	2	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
COG3757	Acm	4.99e-60	37	240	59	265	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
cd00599	GH25_muramidase	1.24e-57	42	228	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.09e-52	44	219	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI43433.1	6.42e-181	1	241	1	241
AKJ41073.1	4.99e-109	1	239	1	239
VEJ53388.1	4.99e-109	1	239	1	239
QBH98634.1	1.14e-102	21	241	19	238
QLL57375.1	4.67e-95	25	239	25	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.51e-59	37	236	12	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	2.22e-28	37	241	1	215	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.59e-19	41	228	20	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.53e-19	41	228	20	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZM8_A	7.86e-17	41	240	2	206	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	1.13e-36	39	239	65	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	1.59e-36	39	239	65	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
Q8FFY2	4.41e-36	39	239	65	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	6.34e-27	37	241	78	292	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	9.18e-16	35	228	3	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29