CAZyme Information: MGYG000002386_00344

Basic Information

• Species: Lactiplantibacillus plantarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus plantarum
• CAZyme ID: MGYG000002386_00344
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000002386_1|CGC5	46847.79	5.3002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002386	3412302	Isolate	China	Asia

• Gene Location: Start: 359889; End: 361088 Strand: +

Full Sequence      

MIKFKERGNVSFSNFRLKEHQCDYEPIIGLIMVKNQERRILQTLESIVNICDQIIMVDTG
SSDNTVAIVESNYNSVLIKHVDWKEDYAAMRNKCLTFVPNDTWVLFVDSDEIFSKEYNSE
EIKSFLYEVDKRFPNQDKICTVKQMQPDRPTYVRPERFVKKTETLYYFGYVHEEPRTKRT
EKLVKIDTDLELMNNGLTKGEYAKFNKQQRYAMLLKKNIALEPDNPRWTSLISPIDIQLG
LFEHDKYVEKLKKEILKDIHGDITENNVKQGEYLNYLLERYCIELVHSENMELASKYIKF
SKKKFPYDVTFIVLEMTIFFTSLEQASLRELKKIIDFTNNTDFNIIDSESEGSEDALSAV
VIKLLLLVEKFDQAKAVYKTISDPIAKELLNDEKKILES

Enzyme Prediction     

No EC number prediction in MGYG000002386_00344.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	5.44e-45	26	263	1	227	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
TIGR04195	S_glycosyl_SunS	1.28e-20	21	397	53	415	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
pfam00535	Glycos_transf_2	1.09e-09	33	117	6	95	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13704	Glyco_tranf_2_4	1.32e-08	34	126	1	97	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd00761	Glyco_tranf_GTA_type	6.28e-08	30	126	2	103	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL77701.1	6.80e-292	1	399	1	399
QKK60541.1	6.80e-292	1	399	1	399
QHS21256.1	6.80e-292	1	399	1	399
ASL37619.1	6.80e-292	1	399	1	399
QRG95027.1	6.80e-292	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSN_A	1.02e-21	21	389	50	402	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSP_A	1.65e-20	21	306	50	322	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSK_A	5.60e-15	2	374	42	399	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31986	5.58e-21	21	389	50	402	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	5.58e-21	21	389	50	402	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
Q92IX8	2.76e-09	25	120	7	98	Uncharacterized glycosyltransferase RC0292 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0292 PE=3 SV=1
Q4UMM0	3.74e-09	25	120	2	93	Uncharacterized glycosyltransferase RF_0337 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0337 PE=3 SV=1
Q1RJ60	9.82e-09	25	120	7	98	Uncharacterized glycosyltransferase RBE_0523 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0523 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002386_00344.