CAZyme Information: MGYG000002386_00695

Basic Information

• Species: Lactiplantibacillus plantarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus plantarum
• CAZyme ID: MGYG000002386_00695
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220		23161.8	6.1201

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002386	3412302	Isolate	China	Asia

• Gene Location: Start: 744096; End: 744758 Strand: -

Full Sequence      

MKKLLTTILTTSAATVGLLLAGTVSAHADATYTVKKGDCVWAISQEYKTTIESIETANNI
HGHLILPGQQLRIPGVNAQDLTSQAPATPVVSAPVQQAPVTTPTQPAETQAATTTQTTPA
QTNETVASAPATTPATESYSGDNLQSYVLGQMQARTGVDAGTWNHIINRESNWQPHVVNG
ASGAYGLFQNIHISGGSVQQQIDAAVNLYHAQGMQAWALY

Enzyme Prediction     

No EC number prediction in MGYG000002386_00695.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01476	LysM	5.99e-12	32	74	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.82e-10	31	73	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	4.90e-09	31	73	1	44	Lysin motif.
PRK06347	PRK06347	1.89e-08	25	73	543	591	1,4-beta-N-acetylmuramoylhydrolase.
cd13925	RPF	2.81e-08	162	217	2	68	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA86581.1	3.69e-131	1	220	1	220
QKK58715.1	3.69e-131	1	220	1	220
QGY63098.1	3.69e-131	1	220	1	220
QAR90185.1	3.69e-131	1	220	1	220
ADN99696.1	3.69e-131	1	220	1	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	6.97e-06	30	74	3	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMZ9	2.30e-16	143	219	158	235	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=isaA PE=3 SV=1
Q5HL49	2.30e-16	143	219	158	235	Probable transglycosylase IsaA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=isaA PE=3 SV=1
Q4A0G5	1.66e-12	148	220	168	243	Probable transglycosylase IsaA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=isaA PE=3 SV=1
Q2YWD9	2.43e-10	152	217	165	231	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=isaA PE=3 SV=1
A7X6T9	4.58e-10	152	217	165	231	Probable transglycosylase IsaA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) OX=418127 GN=isaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999110	0.000168	0.000181	0.000158	0.000147

TMHMM  Annotations     

start	end
4	26