CAZyme Information: MGYG000002386_00866

Basic Information

• Species: Lactiplantibacillus plantarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus plantarum
• CAZyme ID: MGYG000002386_00866
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	MGYG000002386_1|CGC11	49200.67	12.5

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002386	3412302	Isolate	China	Asia

• Gene Location: Start: 928582; End: 929883 Strand: +

Full Sequence      

MMGIKRLSWLVGMAVVATLGMQITVQAQGHAVVDISEWQGQLSPSQVQAMKSQVLFVINR
RQYGLNYVDRDAANNTALYVRYGIPFGEYDFSQFTDAASARREAQAFYARSNKAARFYAL
DFEVNTVRSGSTNAAVAAWYREMRALTNKKLIFYSYASFALTYANQARQRFDAQWIGALT
PNPPIISAALWQYTNRYHLAGLAAPVDNSRVITSVHPVSWWLGTAHGAPSVVIKAQPRLK
VMHDRHLTMPAHNQQHGRAGQAVVAIKRPAVQPAVKTRPVQQKAVSNKSRSQTVVRVKRR
SLQTISVNSHHGKITQHRVIRRRATQPKVIKLKATRRTGTQFKLNTSKATKLRRPGKSIR
TKPVARSKGRTRQRLTRRQPSLRQRVTRNRQSRRHTLRVTVQRRGSTIRRAPRRQRTQIR
PVHNTSRDKRGLS

Enzyme Prediction     

No EC number prediction in MGYG000002386_00866.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	33	202	1.7e-28	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	4.52e-61	31	211	1	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	9.93e-22	32	207	2	182	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	6.45e-18	33	202	1	180	Glycosyl hydrolases family 25.
cd06522	GH25_AtlA-like	2.55e-14	32	209	3	189	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
cd06414	GH25_LytC-like	2.88e-11	32	207	3	186	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN99524.1	3.75e-244	2	433	1	432
ATL79679.1	3.75e-244	2	433	1	432
QDX85259.1	3.75e-244	2	433	1	432
AYA96131.1	3.75e-244	2	433	1	432
QSQ83325.1	3.75e-244	2	433	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMC_A	6.82e-19	29	225	5	192	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
4JZ5_A	2.48e-09	32	207	25	208	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.998956	0.000207	0.000185	0.000168	0.000167

TMHMM  Annotations     

start	end
7	25