CAZyme Information: MGYG000002386_02342

Basic Information

• Species: Lactiplantibacillus plantarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus plantarum
• CAZyme ID: MGYG000002386_02342
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212	MGYG000002386_1|CGC35	24103.5	10.4939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002386	3412302	Isolate	China	Asia

• Gene Location: Start: 2413862; End: 2414500 Strand: -

Full Sequence      

MAGKRRKSRRKQRAKSQLFVKKGRLQWVNILLVLAAMVGMVWYIQHNWAVKSRVTATAPT
TTHAAFIKKLVPAAQQLDQQYHVLASITLSQAILESDWGQSTNATENNNLFGVKSTSGRL
MTTQEYYDGAYHTVKRRFAVYDSWHASLVDHAKKLAYGTTWDSQHYAAVIKATDYQTAAQ
ALQTAGYATDPSYAQKLINIIQKYDLQRYDRK

Enzyme Prediction     

No EC number prediction in MGYG000002386_02342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	71	206	4.1e-35	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.32e-58	66	211	46	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.39e-32	66	212	323	474	amidase domain-containing protein.
NF038016	sporang_Gsm	2.13e-32	66	210	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
TIGR02541	flagell_FlgJ	2.21e-31	66	203	151	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
smart00047	LYZ2	1.32e-30	66	207	11	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALV15364.1	1.40e-147	1	212	1	212
QDX83915.1	1.45e-147	1	212	2	213
AYA97495.1	1.45e-147	1	212	2	213
ASZ33143.1	1.45e-147	1	212	2	213
AOB21478.1	1.45e-147	1	212	2	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	7.64e-22	56	210	24	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	5.42e-19	66	203	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	7.64e-19	66	203	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.45e-16	65	201	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.81e-16	65	201	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.95e-36	66	210	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	8.41e-20	65	203	151	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	8.41e-20	65	203	151	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P37710	1.84e-17	55	210	172	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P15931	4.12e-17	66	203	155	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999960	0.000080	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
25	44