CAZyme Information: MGYG000002386_02906

Basic Information

• Species: Lactiplantibacillus plantarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactiplantibacillus; Lactiplantibacillus plantarum
• CAZyme ID: MGYG000002386_02906
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		35029.95	9.512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002386	3412302	Isolate	China	Asia

• Gene Location: Start: 3005633; End: 3006700 Strand: -

Full Sequence      

MKVNIKQVMLGTAALAGMLVTSQAVANADSMTIKAGDTVWAYAQKYHVSVDKIAEANGLS
NPNLIIAGKTINIPGVKTGEKVTTKTTTASASSAKSTSAATSTSSQATSAAATSSSTTSA
SSTSQAVSSSSVAAQSSSTSTASASSVTSSASTSSVASQASSSAVTSSATSQSSASQSSA
SQASQSSTSVASSTSTTATSTQSAATSTSSQASSTASNTTSSSTTTATATAYSASASTST
STTSSTASYSSVIAAAKTFIGTPYEQMDCSAFTQAAFAKVGRSIGRTTYAQATIGTHVSF
SQAQAGDLIFWGSDSAPYHVGIYLGGGQYIASPTYGETVSIKSTAYYTPSFAIHM

Enzyme Prediction     

No EC number prediction in MGYG000002386_02906.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	1.27e-26	261	349	1	98	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	8.62e-19	252	351	78	193	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
NF033742	NlpC_p60_RipB	3.08e-15	252	349	80	198	NlpC/P60 family peptidoglycan endopeptidase RipB.
PRK13914	PRK13914	5.73e-13	252	330	369	454	invasion associated endopeptidase.
PRK10838	spr	3.77e-12	261	351	86	178	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMX11635.1	6.64e-110	1	355	1	355
QQM60794.1	6.64e-110	1	355	1	355
QSW66663.1	6.64e-110	1	355	1	355
QHM46220.1	6.64e-110	1	355	1	355
AHN70445.1	6.64e-110	1	355	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	5.02e-25	252	355	31	142	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
2EVR_A	2.51e-08	261	332	130	201	ChainA, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_A Chain A, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102],2FG0_B Chain B, COG0791: Cell wall-associated hydrolases (invasion-associated proteins) [Nostoc punctiforme PCC 73102]
2HBW_A	1.35e-07	261	332	119	190	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]
4XCM_A	2.09e-06	252	343	117	214	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
4Q4T_A	4.25e-06	268	349	382	464	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	7.48e-23	252	355	405	516	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
Q8NNK6	8.44e-11	252	346	101	200	Probable endopeptidase Cgl2188 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl2188 PE=3 SV=1
A4QFQ3	8.70e-11	252	346	103	202	Probable endopeptidase cgR_2070 OS=Corynebacterium glutamicum (strain R) OX=340322 GN=cgR_2070 PE=1 SV=1
Q01835	4.79e-10	254	339	401	493	Probable endopeptidase p60 OS=Listeria grayi OX=1641 GN=iap PE=3 SV=1
P21171	1.45e-09	252	330	372	457	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999102	0.000166	0.000185	0.000161	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002386_02906.