CAZyme Information: MGYG000002387_00844

Basic Information

• Species: Lactobacillus paragasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus paragasseri
• CAZyme ID: MGYG000002387_00844
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002387_1|CGC14	42570.48	9.9634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002387	2129154	Isolate	South Korea	Asia

• Gene Location: Start: 830801; End: 831919 Strand: -

Full Sequence      

MKVKNLILILGTIIAYLGIIGYVRMSNDRTLEERYYHEWREDYIKNKNQNEQYVNAAGEK
GPSFALSEAQGYGMLLAAKAGEKHLGSRIDFQKLDNYYLAHRLTNSNLMSWRQKDRKNIW
RDNPVSASDGDIMIAQALLHANRVWPGHGYKSQAVNLINDIKRFEINQKAKMVTVGNWAN
KDSRFYNVLRTSDVMPKAFEEFYQATGDREWLTIKSKMLNYLQKLSKKHDTGLVPDFAWV
SNNYVKPAKANEVATNDDGHYSTNACRVPMLLAESNDKNAAQVVKKMLKFFKKKGTSAGF
TLKGKKLHYYQSASFSAPIFVAANKYRNQGYDTLVEQEKYIFSRSLPKDNYYDATLTTLA
ALNTNELTGLEK

Enzyme Prediction     

No EC number prediction in MGYG000002387_00844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	35	362	1e-71	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.22e-18	36	270	8	228	Glycosyl hydrolases family 8.
COG3405	BcsZ	3.45e-13	67	363	55	343	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	3.04e-06	67	166	54	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTP19686.1	2.67e-273	1	372	1	372
ART98164.1	2.67e-273	1	372	1	372
QHC52359.1	2.67e-273	1	372	1	372
QTD65807.1	3.49e-269	1	372	1	372
VEF34435.1	4.75e-267	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	5.95e-31	39	323	69	364	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	5.25e-20	16	345	13	368	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.72e-20	16	345	19	374	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	4.30e-10	67	273	33	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	8.39e-06	67	270	48	243	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	6.20e-30	39	323	69	364	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.71e-19	16	345	69	424	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37701	3.68e-13	66	243	97	265	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P27032	4.61e-07	67	283	52	259	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	2.02e-06	67	270	56	251	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.849966	0.142205	0.004976	0.000471	0.000293	0.002104

TMHMM  Annotations     

start	end
7	26