CAZyme Information: MGYG000002387_01119

Basic Information

• Species: Lactobacillus paragasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus paragasseri
• CAZyme ID: MGYG000002387_01119
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	MGYG000002387_1|CGC19	57250.29	8.7911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002387	2129154	Isolate	South Korea	Asia

• Gene Location: Start: 1108064; End: 1109542 Strand: +

Full Sequence      

MKYYHVPQDFRWGVATAANQVEGAWNEDGKGLSIADCERYDPKKAKAGYKVANDITSSEI
QKAIKDKKSDGWGKRHGVDFYHTYPEDIKKLAATGINTFRTSIAWSRIFSNGDDPEPNEK
GLKFYDNLFDELHKYNIEPIITLSHYEMPLNLVLNYDAWYDPKVRDYFMRFAKIVVDHFH
KKVKYWIPINEIDSILRHPFSSAGLVKDRFPNKNFEKVIYQAMHNQFVAAALITKYIHEN
YTDLVVGSMITSTMVYPYNSDPRNSLKSVQVMRESYNFSDIQIRGNYPLNLLSKLKKLNV
KITEKELKVIRDNTADFVAFSYYSSICTAFDTTGLKITKANRTEGVYNKYLPTSDWGWQI
DPVGLRIILINLYDRYQKPLFIVENGLGAKDSLTESGKVHDDYRIDYLRKHIRQMLISLE
NDGIELMGYCMWGMTDMISASTTQMSKRYGLIYVDLDDLGNGSYRRYLKDSYFWYQKLLS
FGDKIPKDYLDK

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	479	8.6e-130	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	1.56e-167	7	480	5	467	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	2.92e-167	7	478	5	449	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	7.48e-156	7	480	5	470	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	2.54e-153	7	480	7	471	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.55e-149	1	480	1	471	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ART98418.1	0.0	1	492	1	492
QHC53910.1	0.0	1	492	1	492
QTP21373.1	0.0	1	492	1	492
ASY54707.1	0.0	1	492	1	492
BBD49333.1	0.0	1	492	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.28e-147	7	479	9	462	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.52e-144	7	487	21	487	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	8.66e-142	1	485	3	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	4.56e-131	6	485	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.29e-130	6	485	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.08e-150	7	480	9	463	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.42e-146	7	484	8	469	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	4.74e-141	1	485	3	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	2.44e-137	7	480	5	456	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	5.04e-137	7	480	6	457	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002387_01119.