CAZyme Information: MGYG000002387_01147

Basic Information

• Species: Lactobacillus paragasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus paragasseri
• CAZyme ID: MGYG000002387_01147
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MGYG000002387_1|CGC20	71449.29	8.8504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002387	2129154	Isolate	South Korea	Asia

• Gene Location: Start: 1134607; End: 1136457 Strand: +

Full Sequence      

MGDKTGFLNKRHYAYENWNTDNPEPQVESFTRLYKSVPFLIGLKNNHPYGIFFDNTYHSY
FDLGKESNKYYYYAADDGNIDYYIIGGSSLKKVVENYTYLTGRTPLPQKWTLGYQQSRWG
YSISAEKVGEIVDKMRKYHLPCDAIHLDIDYMDGYRVFTWRTDTYDDPKKFINKLHKLGL
HIITIIDPGVKKDESYQIYQEGLKKGYFVKAPNGQVYVNKVWPGDAVYPDFGRKAVRKWW
AENCKFLVDLGVDGIWDDMNEPASFNGEIPEDIIFSDEDKKSTHGKIHNVYGHNMAKATY
NGLKKASGKRPFVITRAAYAGTQKYSTVWTGDNQSLWVHLQMMIPQLCNLGMSGFAFAGT
DIGGFGADTTPELLTRWIEAAIFSPLLRNHAALGTRSQEPWVFGEPTLSTYRKYLQLRYH
FIPYLYDLFVKESKNGLPLMRPLVLNYPTDSMVKNMNDEYMVGTRILVAPVVEEGKNFRA
VYLPQGEWIDFWNNVTYSGNNTILVNAPLDKLPLFIKKDTILPWGKLKNHISSKPDEKMI
FRVFGEHGNYTHYQDNGADFAYKNGEYNLYEINIDKNRTSINLKKHGYQPIYQRIELRAM
DKKIDFIFKDQKYIQI

Enzyme Prediction     

EC	3.2.1.84

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	82	522	7.4e-168	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	1	616	158	762	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06604	GH31_glucosidase_II_MalA	0.0	102	436	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	0.0	83	522	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	8.24e-164	102	523	1	427	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	1.23e-125	3	581	87	659	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD49308.1	0.0	1	616	157	772
VEF36495.1	0.0	1	616	157	772
ASY54733.1	0.0	1	616	152	767
ABJ61017.1	0.0	1	616	177	792
QTH66961.1	0.0	1	616	152	767

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJW_A	3.43e-118	2	584	68	643	Crystalstructure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	1.89e-114	1	612	161	790	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6CA1_A	4.20e-114	1	566	56	659	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA1_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
6C9X_A	5.91e-114	1	566	56	659	ChainA, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9X_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]
6JR8_A	2.83e-113	1	612	161	790	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	1.45e-185	1	593	152	750	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P0CD66	1.10e-110	1	523	67	609	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1
D0KQM8	1.32e-110	1	523	67	609	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1
B9F676	5.98e-107	15	595	255	862	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q9FN05	1.70e-106	15	567	252	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002387_01147.