CAZyme Information: MGYG000002387_01598

Basic Information

• Species: Lactobacillus paragasseri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus paragasseri
• CAZyme ID: MGYG000002387_01598
• CAZy Family: GH68
• CAZyme Description: Levansucrase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		39204.74	4.9418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002387	2129154	Isolate	South Korea	Asia

• Gene Location: Start: 1597782; End: 1598867 Strand: +

Full Sequence      

MEEENGDRYLVFEANTGSDNYQGEDQVYRWANYGGNDKFNVNNFLSYFGNNDDQALASVA
NGALGILKLSGDQNNPTVKLDDVYSPLVTSLMVSDEMERPDIVKVGNKYYLFSATRLSRR
TKGEITRLANKVVGDNVAMIGFVSDSLTHGYVPLNGSGVVLTASVPANWRTATYSYYAVP
IEGKENQLLITAYMTNRGEVAGKGNNSTWAPSFILQLNPDNTTTVLAKLTNQGVWVWNGD
SENKNMIGSLEKDSPNSAALDGEWGKFIDWDAINSYSLKPHQPVTPNVPTTPEKPENPTT
PNTPDTPRTPEVPTTPVKKTTQSELPKAGAKDGIAATILGAVSSMLGVIGLAGISKRKRN
N

Enzyme Prediction     

EC	2.4.1.10	2.4.1.9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH68	3	235	8.1e-68	0.4844124700239808

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08997	GH68	7.00e-54	4	225	164	354	Glycosyl hydrolase family 68, includes levansucrase, beta-fructofuranosidase and inulosucrase. Glycosyl hydrolase family 68 (GH68) consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9), all of which use sucrose as their preferential donor substrate. Levansucrase, also known as beta-D-fructofuranosyl transferase, catalyzes the transfer of the sucrose fructosyl moiety to a growing levan chain. Similarly, inulosucrase catalyzes long inulin-type of fructans, and beta-fructofuranosidases create fructooligosaccharides (FOS). However, in the absence of high fructan/sucrose ratio, some GH68 enzymes can also use fructan as donor substrate. GH68 retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Biotechnological applications of these enzymes include use of inulin in inexpensive production of rich fructose syrups as well as use of FOS as health-promoting pre-biotics.
pfam02435	Glyco_hydro_68	1.68e-52	2	227	211	411	Levansucrase/Invertase. This Pfam family consists of the glycosyl hydrolase 68 family, including several bacterial levansucrase enzymes, and invertase from zymomonas.
cd08979	GH_J	2.40e-09	57	215	149	291	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00746	Gram_pos_anchor	0.003	318	361	2	43	LPXTG cell wall anchor motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF35911.1	3.36e-228	1	361	178	538
ACZ67287.1	2.67e-226	1	361	408	768
BBD48912.1	2.67e-226	1	361	408	768
QTQ39430.1	5.86e-213	1	361	388	758
AOG27122.1	3.16e-182	1	361	228	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFS_A	4.52e-136	1	282	286	565	Crystalstructure of inulosucrase from Lactobacillus johnsonii NCC533 in complex with sucrose [Lactobacillus johnsonii]
2YFR_A	4.52e-136	1	282	286	565	Crystalstructure of inulosucrase from Lactobacillus johnsonii NCC533 [Lactobacillus johnsonii],2YFT_A Crystal structure of inulosucrase from Lactobacillus johnsonii NCC533 in complex with 1-kestose [Lactobacillus johnsonii]
3OM6_A	2.29e-44	3	233	234	449	ChainA, Levansucrase [Priestia megaterium],3OM6_B Chain B, Levansucrase [Priestia megaterium],3OM6_C Chain C, Levansucrase [Priestia megaterium],3OM6_D Chain D, Levansucrase [Priestia megaterium]
3OM7_A	2.29e-44	3	233	234	449	ChainA, Levansucrase [Priestia megaterium],3OM7_B Chain B, Levansucrase [Priestia megaterium],3OM7_C Chain C, Levansucrase [Priestia megaterium],3OM7_D Chain D, Levansucrase [Priestia megaterium]
3OM5_A	2.29e-44	3	233	234	449	ChainA, Levansucrase [Priestia megaterium],3OM5_B Chain B, Levansucrase [Priestia megaterium],3OM5_C Chain C, Levansucrase [Priestia megaterium],3OM5_D Chain D, Levansucrase [Priestia megaterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3WYW0	5.34e-227	1	361	408	768	Levansucrase OS=Lactobacillus gasseri OX=1596 GN=levG PE=1 SV=1
Q74K42	5.55e-151	1	361	429	797	Inulosucrase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=inuJ PE=1 SV=1
D3WYV9	1.29e-134	1	285	423	705	Inulosucrase OS=Lactobacillus gasseri OX=1596 GN=inuGB PE=1 SV=1
Q70XJ9	1.72e-119	1	284	470	754	Levansucrase OS=Fructilactobacillus sanfranciscensis OX=1625 GN=levS PE=1 SV=1
P11701	9.15e-109	1	283	404	679	Levansucrase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=ftf PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
333	355