CAZyme Information: MGYG000002388_00573

Basic Information

• Species: Lacticaseibacillus paracasei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus paracasei
• CAZyme ID: MGYG000002388_00573
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002388_1|CGC6	35797.57	6.5984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002388	3076437	Isolate	China	Asia

• Gene Location: Start: 590846; End: 591856 Strand: +

Full Sequence      

MKTLSKRWLLRLIFGSLSSFVLLFVLFMVLIAAMFAGLNDKKGGGSDCDITGSISATGNF
NKDTYQQAWSKYFTSGVLKDEADYTIKAANKAGVSPALFASIMGHESGWGKSSAVRNQNN
PSGQMSGSTIISYPTIESGIDATAATLHNLVVERQLSTVEKLGSVYCPVGAANDPTGLNA
SWVPSVKKTMLEFGADASATLATTCNSGAGSVGNGSAIITEAKKYLGVPYVWGGKSPATG
MDCSGFVGYVLMQVTHKSYPQYTVSLESKGTMLFNGGKPVMNELQPGDMIFYGDHGASHH
IAFYAGDGQVIEEPEPNDVCHIRPYKDYEPDFAVRP

Enzyme Prediction     

No EC number prediction in MGYG000002388_00573.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0791	Spr	3.09e-18	162	324	17	181	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
pfam00877	NLPC_P60	2.08e-17	227	314	1	81	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	3.55e-15	132	311	267	454	invasion associated endopeptidase.
NF033741	NlpC_p60_RipA	1.13e-14	218	324	331	441	NlpC/P60 family peptidoglycan endopeptidase RipA.
NF033742	NlpC_p60_RipB	2.22e-11	170	312	17	178	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU58629.1	2.10e-245	1	336	1	336
AGP67369.1	1.42e-243	1	336	1	336
CAQ65721.1	2.01e-243	1	336	1	336
AZP97959.1	2.01e-243	1	336	1	336
QDP35869.1	2.01e-243	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	3.33e-28	210	334	24	140	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
7CFL_A	3.24e-11	218	311	17	107	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3NE0_A	1.71e-10	218	326	88	200	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	1.71e-10	218	326	88	200	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3H41_A	1.77e-10	218	324	192	293	CRYSTALSTRUCTURE OF A NLPC/P60 FAMILY PROTEIN (BCE_2878) FROM BACILLUS CEREUS ATCC 10987 AT 1.79 A RESOLUTION [Bacillus cereus ATCC 10987]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	2.89e-25	210	334	398	514	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
Q01835	1.63e-12	206	312	387	485	Probable endopeptidase p60 OS=Listeria grayi OX=1641 GN=iap PE=3 SV=1
Q736M3	2.36e-11	218	324	214	315	Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=ykfC PE=1 SV=1
Q47151	3.77e-11	219	322	123	224	Probable endopeptidase YafL OS=Escherichia coli (strain K12) OX=83333 GN=yafL PE=3 SV=1
P96740	5.91e-11	218	328	169	275	Gamma-DL-glutamyl hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=pgdS PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999880	0.000099	0.000002	0.000001	0.000000	0.000063

TMHMM  Annotations     

start	end
12	34