CAZyme Information: MGYG000002388_00752

Basic Information

• Species: Lacticaseibacillus paracasei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus paracasei
• CAZyme ID: MGYG000002388_00752
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	MGYG000002388_1|CGC10	86648.53	6.2924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002388	3076437	Isolate	China	Asia

• Gene Location: Start: 766882; End: 769269 Strand: +

Full Sequence      

MGVVVSNFHLAKITAEEKVKLTSGKDFWTSEHLADKGIPSFRMSDGPHGLRYQALAADHL
GINDSVPSTSFPTASASAAAWDPDLIQAMGKAIGLEAQSLGVDMVLGPGVNMKRNPLCGR
NFEYFSEDPFLAGKLGAAWINGIQSQGIAACLKHFAANNQENDRLSSDSLVDPTALHEIY
LEAFRIAVTESHPEAVMCSYNKINGTYASDNLYLMTQVLRQQFGFGGAVITDWGALNDKV
AALNAGTDLEMPGDDHLFDGEALQAYQQGTLKLASLDRAVTKIAEIARKQRPKFQGSREQ
LLQANGQLAQKIAESAIVLLKNEAALLPLQATDTVAVIGELAKATRFQGAGSSHINASEI
VSVLDGLKQKKVSFDYAAGYRLDDQDDSQATAEALALARNHDKVVFVAGLPDNYESEGFD
RQNMALPKVQNDLLQAVTAVNPNVIVLLVAGAPVELPWVDQVKAVVNLSLGGERIGAAAA
NVLTGAVNPSGKLAESYPLKYQDVPSADVYDKNPRSVPYVESTYIGYRYYDKAKVPVAFP
FGFGLSYTSFALKNIRLSSDHVTDDQPLTISLQVTNTGQVDGAEVVQVYVQEQQPRPLRP
EKSLKAFKKVFVKAGQTVNVALELKAQAFKEWREQTQTWVLPEAQKAIAVGTSVTNIDAV
LPVSFTGETFNNFATIPNWYTTLSGKPSVQDFEQLTDQKVPAPHEFVPGEFTRLNTPREM
KKHSLLLRLVAWITVKIRTKDYIDKQGPEAKFQQAIVLDTPLIRLAQQASGALKLSMVDR
LVAAANHQYVKMIFR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	252	9e-71	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.80e-82	37	637	103	738	beta-glucosidase BglX.
COG1472	BglX	1.19e-68	37	370	59	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.28e-59	317	547	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	4.03e-54	37	622	80	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.66e-39	40	286	56	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ64068.1	0.0	1	795	1	795
QPC25508.1	0.0	1	795	1	795
QPI88918.1	0.0	1	795	1	795
QQX71668.1	0.0	1	795	1	795
QQX68820.1	0.0	1	795	1	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.65e-186	10	657	9	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.79e-160	13	668	12	666	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.34e-115	10	657	8	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.00e-114	10	657	8	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.81e-109	10	660	10	831	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.74e-185	10	657	9	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.72e-160	13	668	12	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.83e-160	13	668	12	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	7.32e-115	10	657	50	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	1.13e-104	10	670	15	843	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002388_00752.