CAZyme Information: MGYG000002388_01519

Basic Information

• Species: Lacticaseibacillus paracasei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus paracasei
• CAZyme ID: MGYG000002388_01519
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206		22058.52	9.8489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002388	3076437	Isolate	China	Asia

• Gene Location: Start: 1486487; End: 1487107 Strand: +

Full Sequence      

MAEKDEHQHDNEDHKRTNGEDPSKPWETLFEDDRDDQGNLSRVATKKKRQGSSKLTWILA
ILLILVVLAPIIYVKISGDQSRNGANLSNDRVVIQSTKKSSKVSKSKKSSKASKASKTSV
ASSQAASTQPSQAPSVTSQQEEQTSASAQPSEQASASTAGSSYTVQAGDNLYRIAVNHGM
TLDELLQMNGMSAGSSIAPGTVLKVK

Enzyme Prediction     

No EC number prediction in MGYG000002388_01519.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	6.52e-13	162	205	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	6.12e-11	163	206	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	2.38e-09	163	205	2	44	Lysin motif.
PRK10783	mltD	3.00e-06	146	205	328	387	membrane-bound lytic murein transglycosylase D; Provisional
COG1388	LysM	3.92e-06	130	206	36	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH68609.1	2.91e-105	1	206	1	206
QKK93278.1	2.91e-105	1	206	1	206
AKU59563.1	2.91e-105	1	206	1	206
QPC29074.1	2.91e-105	1	206	1	206
QPC26155.1	2.91e-105	1	206	1	206

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999922	0.000108	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
55	74