CAZyme Information: MGYG000002388_02737

Basic Information

• Species: Lacticaseibacillus paracasei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus paracasei
• CAZyme ID: MGYG000002388_02737
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002388_1|CGC28	54720.57	6.2255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002388	3076437	Isolate	China	Asia

• Gene Location: Start: 2773920; End: 2775350 Strand: -

Full Sequence      

MTIQFDADFVWGAATSGPQAEGTFHKKHENIFDYHYHTRPQDFYHNVGPDVASNFYNDYE
NDLALLKQAGVQALRISIQWTRLIDDLESGTVDPVGADYYRRVFKTMHQLGITPYVNLHH
FDLPVTLQHQYGGWQSKHVVDLYVKFATRCFELYSDQVTHWFTFNEPKVIVDGQYLYQFH
YPNIVDGRLAVQAAYNLNLASAKAVAAFRQINRQPQGTIGTIVNLTPVYPASQAPENLAA
ARFAEQWANDLYLEPAIHGRFPEELVARLKRDGVLWEATPDELAVIAANRIDVLGVNYYH
PFRVQAPAVSPDSLQAWLPDIYFDNYDMPGRKMNLDKGWEIYPDALYDIAMTIKRRYDNL
PWFVAENGIGVANEERFLKDGMVQDDYRIQFMTDHLRFLSQAIAEGANCHGYFVWTGIDC
WSWLNAYKNRYGLIRNDLRNQTKSLKKSGHWFSQVAATGLVAPTLRPFESEEKNHG

Enzyme Prediction     

No EC number prediction in MGYG000002388_02737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	457	8.5e-133	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	4	465	3	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	6.70e-121	1	458	1	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	5.82e-101	1	458	1	465	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	2.68e-66	5	458	4	471	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.87e-58	8	458	9	472	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDR74461.1	0.0	1	476	1	476
QHQ65002.1	0.0	1	476	1	476
BBF75564.1	0.0	1	476	1	476
AKU60799.1	0.0	1	476	1	476
QPC24576.1	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NAV_A	3.73e-230	3	455	18	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	1.07e-229	3	455	18	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
4B3K_A	2.08e-201	3	456	1	456	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.24e-200	3	456	2	457	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
6Z1H_A	3.46e-97	2	455	8	444	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	5.30e-143	4	456	8	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	5.28e-79	3	455	4	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q08638	5.96e-77	4	455	5	438	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	5.16e-74	4	455	3	436	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P10482	3.79e-73	1	454	1	448	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002388_02737.