CAZyme Information: MGYG000002389_00155

Basic Information

• Species: Latilactobacillus sakei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus sakei
• CAZyme ID: MGYG000002389_00155
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		31164.24	4.728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002389	1957804	Isolate	not provided	not provided

• Gene Location: Start: 153688; End: 154539 Strand: +

Full Sequence      

MMKSILLVGQSNMAGRGFIQDVPVLRHERVKMLRNGRWQMMAEPIHFDREVAGVGPATSF
AAAWVQAHPDEELGLIPCAEGGSSIDEWASDEVLMRHAIAEAKFAQEFSELIGVLWHQGE
SDSLKGGYQTYAAKLTAVFSHLRQALGQANLPIIVGQLPDFLGQEGFGASATEFNDINRE
MANVVAQDPHSYLVNAAELTANPDGIHIDAASQRRFGLRYYAAFANQEDVLAVLPDEAIQ
LEALYQRPETPQEKMYRLSRAFALGQMSYPEFIAQLTGEGTAK

Enzyme Prediction     

No EC number prediction in MGYG000002389_00155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	55	146	7e-29	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	1.27e-67	6	224	6	224	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ60354.1	1.14e-125	2	277	1	276
QPG52963.1	1.10e-109	1	276	1	276
QWC23644.1	2.22e-109	2	272	1	271
QSX19130.1	3.63e-108	2	272	1	271
QTC41563.1	1.04e-107	2	272	1	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	1.44e-103	3	276	3	276	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]
2APJ_A	7.76e-17	6	226	26	257	X-RayStructure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_B X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_C X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_D X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L9J9	8.57e-17	6	226	26	257	Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002389_00155.