CAZyme Information: MGYG000002389_00785

Basic Information

• Species: Latilactobacillus sakei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus sakei
• CAZyme ID: MGYG000002389_00785
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000002389_1|CGC4	39456.72	9.0288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002389	1957804	Isolate	not provided	not provided

• Gene Location: Start: 747998; End: 749098 Strand: +

Full Sequence      

MRVMISGGGTGGHIYPALALIERLKQRGLLDAVLYVGTERGLESKIVPDQGIDFKTLEIQ
GFKRSMNLNGIKTNLKTIELFMSSIKSAKKMIKEFKPDVVIGTGGYVSGSLLYAASRLKV
PTIIHEQNSAAGVTNKFLARFVDKVAISFESVSDQFPMHKVVLTGNPRAQQVAGMVPNER
LSEFGLKTDSPTVMIFGGSRGAPSINKAFIDAVPLLNERDYQVLFVSGQVHYENVQAALA
NTTLNSNLAFVPYISNMPEVLPDLKAIVGRAGATSLAEITALGIPSILIPSPYVTNDHQT
KNAQSLVKEDAAILIPEPELTGASLVKALDTLFETPEKQHAMAKAAKKSGIPDASDRIIE
VIETII

Enzyme Prediction     

No EC number prediction in MGYG000002389_00785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	354	1.4e-48	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.77e-158	1	366	2	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.98e-144	2	361	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	8.32e-117	1	362	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	2.06e-116	1	366	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	7.16e-47	192	358	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST83297.1	1.77e-259	1	366	1	366
AWZ44012.1	1.77e-259	1	366	1	366
SON73030.1	1.77e-259	1	366	1	366
AYG25156.1	1.77e-259	1	366	1	366
AYG30466.1	1.77e-259	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.12e-55	2	360	4	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.51e-54	2	363	11	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.30e-47	2	358	8	346	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q38XM8	4.11e-256	4	366	1	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Latilactobacillus sakei subsp. sakei (strain 23K) OX=314315 GN=murG PE=3 SV=1
Q88V81	1.74e-162	1	366	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=murG PE=3 SV=1
Q1WTA0	6.01e-154	1	365	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=murG PE=3 SV=1
Q03EY2	7.24e-152	1	365	1	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w) OX=278197 GN=murG PE=3 SV=1
Q03QH5	5.16e-150	1	365	1	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002389_00785.