CAZyme Information: MGYG000002389_01189

Basic Information

• Species: Latilactobacillus sakei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Latilactobacillus; Latilactobacillus sakei
• CAZyme ID: MGYG000002389_01189
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000002389_1|CGC7	24454.79	8.2684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002389	1957804	Isolate	not provided	not provided

• Gene Location: Start: 1158025; End: 1158720 Strand: -

Full Sequence      

MKSLKTLLFSATLSTAATAGLLFASNGHADAATNYTVVSGDTLSSISQKFAGNGSLIEKI
ANANKIANKNLIYVGETLTIDEETQTVTVAPATTQAATTTPVATQQTTQATTTPVATQQP
VQKAATQTQPVQQQATTTPVVKQQQTTTTTTTTNTTTSTTNSAKEWIANKESGGSYSASN
GQFVGRYQLSSSYLNGDYSASNQERVADQYVTSRYGSWEGAKSFWLANGWY

Enzyme Prediction     

No EC number prediction in MGYG000002389_01189.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.34e-10	35	80	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.30e-10	35	80	2	44	Lysin motif.
PRK11198	PRK11198	8.85e-10	26	80	89	145	LysM domain/BON superfamily protein; Provisional
pfam01476	LysM	2.40e-09	35	80	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1652	XkdP	2.61e-05	28	80	206	261	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU85603.1	1.75e-109	1	231	1	231
SON67905.1	1.75e-109	1	231	1	231
SON65373.1	1.75e-109	1	231	1	231
QPG04022.1	1.75e-109	1	231	1	231
AWZ44401.1	1.75e-109	1	231	1	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999103	0.000151	0.000178	0.000147	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002389_01189.