CAZyme Information: MGYG000002390_00040

Basic Information

• Species: Ligilactobacillus agilis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus agilis
• CAZyme ID: MGYG000002390_00040
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000002390_8|CGC2	54880.03	5.6396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002390	2133539	Isolate	not provided	not provided

• Gene Location: Start: 33285; End: 34691 Strand: +

Full Sequence      

MDKSFLWGGSTSAFQFEGGGHEGRKGKSIYDIREEKTQVKYSVTSDFYHHYKEDIALMAE
MGFSAFRMSIAWTRLYPTGVEETPNFEGIKFYQDVFQELKKNKIEPVVTLFHWDMPQYLV
EKYDGFKSREIITYFERYAETCFKEFGQYVKYWLTLNENNLAMMIPWMYIKDKNNYPKEE
HAQLAWDCYYHSILCHFKAVKRGHELLPDAKFGNMTASAIAYPLTPKPEDVLATQKHNQR
TMWDDLDILTSGKISPSFKQRMADEGVVINISDEDRELMADSNAKIDFISFSYYFSLCTQ
AAENRNNSEAETMQTLYQGFYNPYLSRTSFGWQIDPLGIRIFMNEAYSRYHLPLLVVENG
IGVEDEVLTKDKRVHDDYRIDYLAKHIHQIIKTVDEDKTPVLGFLPWGCIDLYSASGNYN
KRYGFVYVDFEDDLARYKKDSFWWYKKVIASNGKELEKIDSTDCNKQS

Enzyme Prediction     

No EC number prediction in MGYG000002390_00040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	453	2.1e-131	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.04e-172	3	457	6	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	4.75e-152	3	457	6	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	7.66e-141	3	456	6	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.62e-131	3	457	8	478	6-phospho-beta-glucosidase; Reviewed
pfam00232	Glyco_hydro_1	1.98e-128	3	453	7	452	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VED97473.1	4.79e-241	1	456	1	456
QIX08277.1	7.30e-184	1	457	1	470
BCL56683.1	2.54e-133	1	456	1	468
QJA00931.1	1.71e-130	1	457	1	476
QSI24013.1	9.70e-130	1	457	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	7.05e-121	3	456	10	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.64e-113	1	456	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.62e-113	1	456	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	1.34e-112	3	457	13	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4IPL_A	5.12e-111	5	458	24	487	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	5.86e-126	3	458	9	473	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	6.23e-123	3	457	6	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	9.65e-121	3	456	10	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	3.09e-112	3	457	6	463	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P42973	6.93e-112	1	456	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002390_00040.