CAZyme Information: MGYG000002390_00812

Basic Information

• Species: Ligilactobacillus agilis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus agilis
• CAZyme ID: MGYG000002390_00812
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000002390_14|CGC3	43647.6	4.399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002390	2133539	Isolate	not provided	not provided

• Gene Location: Start: 142492; End: 143676 Strand: -

Full Sequence      

MTVMRFPKQFNFGATILAKDDEGGFDQGNKGLTTYDVLTASENVAKLDIEEVLAAVEIEG
LAPYPSRQGVDFYHRLDEDLQTLANLGISQVMVSLSWARLFPKGEELSPNEVGLKFYQIL
LTKIKALGLEPIVILGDGALPLNLSVKYNGWATRRLVADFNRYANACFDNFGQLVSKWVT
FIDLTAVLNAPYLAGGILSQADAETAYQALVHQLLASSLASKNLHEQFQASQLGYGISYQ
VDLTEGRAAFAQNFKQRLLADLVLRGAYSPLLAQLLEQAEIELDLDELDAETLAESKVDF
IYLNWPETQHNLEVALLELTERYQLPIIVGDFSSKYRQNIQAVARALSQKATVVGYFPQV
FNGGLVAVASDLTRQKTAAYNDYQDIIFNNGLEI

Enzyme Prediction     

No EC number prediction in MGYG000002390_00812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	310	1.1e-57	0.6736596736596736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.35e-64	4	393	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	6.25e-62	5	394	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	1.56e-54	3	394	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	6.43e-52	1	301	1	309	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.78e-48	1	391	1	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR41721.1	8.04e-277	1	394	1	394
AMQ98678.1	1.39e-65	6	394	7	486
APE41812.1	1.39e-65	6	394	7	486
QPQ19863.1	1.39e-65	6	394	7	486
AOT80162.1	1.39e-65	6	394	7	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.33e-46	5	301	7	302	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	4.58e-43	6	305	20	318	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	1.11e-42	6	325	11	339	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	2.87e-42	4	391	6	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	7.78e-42	5	301	6	311	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	6.33e-52	6	305	4	310	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.39e-48	5	301	7	302	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.93e-46	4	305	5	304	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	6.30e-44	6	305	4	299	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	7.01e-44	6	305	4	299	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002390_00812.