CAZyme Information: MGYG000002390_01094

Basic Information

• Species: Ligilactobacillus agilis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus agilis
• CAZyme ID: MGYG000002390_01094
• CAZy Family: CBM50
• CAZyme Description: D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000002390_15|CGC1	47911.3	6.9159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002390	2133539	Isolate	not provided	not provided

• Gene Location: Start: 88838; End: 90223 Strand: +

Full Sequence      

MNNTTKKILFGTVGAAGLFLASSASVNADTTHHVVKNDTVWDLSQKYGVSIQSIEQLNKI
NTDTHLIREGQTLTIPATGKTAAKTATKTSQVTVKAGDTLWALAQKYGTTVEKLRQLNGL
ASDAYLIHVGDVIKVDGQVTTTTTTNAQATSTVSSEANQTSQAASTASSEANQTSQAAST
ASSEASQTSQATSTASSEASQAASTSQAATPYVAANHVTYTVQAGDSLYTIAQKYGVTVD
SLRQANTLGATLQVGQSLTVNDPTKNPQASVAASQAEQTPAQTTTTSQATQATQTTQAAT
TTNQVAQTTSQTTSQPAAQTQTSQTTQTSQQTQASQAQVATPSSYSVSALLSYAQTFTGV
PYVLGGTTPAGFDCSGFTQYVFNHFGKNIGRTTYQQQYAGTKLAVSSAQPGDLLFWGAYG
SAYHVGIYLGGSSYIAAPEPGESVSVKSFTYYQPSFAVHVN

Enzyme Prediction     

No EC number prediction in MGYG000002390_01094.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	1.51e-31	359	454	1	98	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	3.32e-26	90	441	28	460	invasion associated endopeptidase.
COG0791	Spr	5.32e-24	341	456	69	193	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK10838	spr	2.09e-17	348	456	68	178	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.
NF033742	NlpC_p60_RipB	5.10e-16	354	446	84	188	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR41509.1	3.67e-236	1	461	1	474
AWZ39822.1	4.79e-125	1	461	1	431
AWZ38852.1	4.79e-125	1	461	1	431
QIA89089.1	1.13e-123	1	461	1	432
QCQ04928.1	1.34e-118	1	461	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	7.96e-34	344	458	25	140	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
2K1G_A	1.52e-14	348	456	7	117	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]
7CFL_A	9.25e-13	349	456	16	131	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3H41_A	3.40e-10	350	446	192	291	CRYSTALSTRUCTURE OF A NLPC/P60 FAMILY PROTEIN (BCE_2878) FROM BACILLUS CEREUS ATCC 10987 AT 1.79 A RESOLUTION [Bacillus cereus ATCC 10987]
2HBW_A	2.34e-09	362	435	115	188	ChainA, NLP/P60 protein [Trichormus variabilis ATCC 29413]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	3.01e-30	344	458	399	514	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
P54421	9.71e-29	5	456	9	328	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O31852	1.46e-26	6	456	3	407	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q01835	1.39e-24	75	444	160	493	Probable endopeptidase p60 OS=Listeria grayi OX=1641 GN=iap PE=3 SV=1
O07532	4.34e-23	6	456	3	481	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999121	0.000161	0.000182	0.000154	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002390_01094.