CAZyme Information: MGYG000002391_02225

Basic Information

• Species: Oceanobacillus caeni
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Oceanobacillus; Oceanobacillus caeni
• CAZyme ID: MGYG000002391_02225
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000002391_42|CGC1	54590.21	4.8615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002391	3564572	Isolate	not provided	not provided

• Gene Location: Start: 34675; End: 36120 Strand: -

Full Sequence      

MNNHKKAIDKANTYIEEKIKEKQERTFQPSYHFTAPVGWLNDPNGLIQHKGIYHLFYQFH
PYSEDWGPMHWGHATSKDLVHWEHQPVALAPSEDYELGKAGEGYGCFSGSAVTNNDQLVL
FYTGHIDSKNPKEVQCMATTEDGIHFEKPAINPIIPNPPETLSADFRDPKVWAYDGVWYM
VVGTSEEGHGGAALFQSKDLMDWQYCGLAAKSDGTLGDMWECPDLFPIQHKHALVVSPMN
MNGGKNIMMVGDMDYKLHRFTKDYFVEVDEGFDFYAAQTFLDEKGRRILFAWMDQWETEF
PTKKEGWAGAMTVPRVVSLNDEGEVRFQPVEELQLLRKGKEQHKHVELTHSFTPETSGQS
LELKVNFDLSNTNSEGIGLHVLKSEDGKEYTEIKYDTSSGEVLVDLNRAGQISGIASAKI
KECDELSLHIYVDRCSVEVFINDGEKVITNRVYPDKGSNRIELFADSTVNVSDLQIWSLE
K

Enzyme Prediction     

No EC number prediction in MGYG000002391_02225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	32	324	2.3e-108	0.9795221843003413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	6.42e-163	13	481	13	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.95e-149	32	444	1	437	Glycosyl hydrolases family 32.
TIGR01322	scrB_fam	7.90e-147	19	455	1	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd08996	GH32_FFase	9.15e-143	38	319	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00251	Glyco_hydro_32N	1.04e-130	32	323	1	301	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJY73871.1	9.26e-169	4	479	6	487
QSS98783.1	3.61e-168	4	480	12	488
QIZ05372.1	6.01e-162	4	480	8	488
QAV18110.1	3.21e-161	4	479	6	485
AZK45352.1	1.81e-160	4	480	10	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.07e-114	5	480	4	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	7.83e-92	14	455	36	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.22e-90	14	455	36	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	7.84e-82	3	474	16	507	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	3.36e-78	4	476	17	509	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F8DVG5	5.73e-111	29	480	30	500	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P0DJA7	8.09e-111	29	480	30	500	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
P40714	1.58e-110	18	471	15	467	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	4.73e-100	17	479	13	475	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P07819	8.04e-89	31	479	32	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002391_02225.