CAZyme Information: MGYG000002391_02356

Basic Information

• Species: Oceanobacillus caeni
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Oceanobacillus; Oceanobacillus caeni
• CAZyme ID: MGYG000002391_02356
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002391_45|CGC1	37244.96	4.497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002391	3564572	Isolate	not provided	not provided

• Gene Location: Start: 17824; End: 18822 Strand: +

Full Sequence      

MKTKGIKLIVYFVLGFMLILLIALFYEAEEQEKIESPDYGVGELNPEVLMYQDYVEAELS
KYGLEDLTNIILAIIQVESGGRVRDVMQSSESIGLPPNSIQDPLVSIQVGIKHFHNVYLK
AQEQSVDVDSVIQSYNFGGGYIDYVSSNGKEHTEDIAFNFSMMQVAKNPSYNCGGDTNNF
RYPACYGNYLYTTKVKSYLTDNSNEGVALDKEAYEIIMNEALKYEGYPYAWGGASPSTSF
DCSGLIMWVYAKAGISLPRTSYEQYKATTPISKDELKKGDLIFFKTANYNPVTHIGIYVG
NNRMYDANNSGIGYSDLNDYWTTKIVGYGRVQ

Enzyme Prediction     

No EC number prediction in MGYG000002391_02356.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	3.94e-65	51	199	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	7.88e-55	45	199	1	165	Lysozyme-like.
PRK13914	PRK13914	9.93e-37	159	331	313	481	invasion associated endopeptidase.
pfam00877	NLPC_P60	6.35e-36	226	330	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	6.00e-33	213	328	74	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZV45669.1	1.04e-138	30	332	42	349
AYZ22475.1	2.37e-87	27	331	32	337
APT18759.1	2.37e-87	27	331	32	337
AKI46274.1	2.37e-87	27	331	32	337
ADX78816.1	2.37e-87	27	331	32	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	2.19e-85	27	331	5	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	5.23e-74	44	332	20	307	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
7CFL_A	9.78e-19	215	331	15	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3I86_A	1.30e-15	206	310	4	117	Crystalstructure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis],3I86_B Crystal structure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis]
3PBC_A	1.11e-14	211	312	82	192	ChainA, Invasion Protein [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.12e-83	12	332	16	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	2.90e-44	51	196	55	201	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P21171	1.31e-26	217	331	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01836	5.47e-26	217	331	355	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01837	2.05e-25	217	331	412	524	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.848373	0.145484	0.003588	0.000430	0.000283	0.001870

TMHMM  Annotations     

start	end
7	26