CAZyme Information: MGYG000002391_02365

Basic Information

• Species: Oceanobacillus caeni
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Oceanobacillus; Oceanobacillus caeni
• CAZyme ID: MGYG000002391_02365
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002391_46|CGC1	48202.3	8.6898

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002391	3564572	Isolate	not provided	not provided

• Gene Location: Start: 1803; End: 3005 Strand: -

Full Sequence      

MKIKDLIIKVRRSKYVSNTLKWLFKLASKLPVQKNTVIFESFSGKQYSDNPKAIYLYMQE
NLPEYNLYWSFDQRYLAKFQNEDLNVLPRFSFKWILRMARAEYWVSNSRLPLWIPKPKHT
TYIQTWHGTPLKKLGVDIKEVHMPGTNTEKYRENFTLEAAKWDYLISPNAYSSEIFRRAF
DFKGTMVESGYPRNDILYTYRESDILKIKENLKLPKDKKVILYAPTWRDDDYYSVGKYKF
DLKLDLTRLQEEFREEFVILLRMHYLVAENLDLSEYEGFAYDVSSYRDINELYIVSDVLI
TDYSSVFFDYANLIKPILFFMYDIVDYREKLRGFYFNIEEQAPGPILKTSEDVEEYLKRI
RDNKFELTPRFNQFYERFCYLEDGSASERVVKEIFKVHTK

Enzyme Prediction     

No EC number prediction in MGYG000002391_02365.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	4.32e-143	31	396	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.06e-107	1	396	1	386	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHA30703.1	6.27e-147	8	395	310	697
QZY86309.1	2.23e-146	8	395	310	697
QWB29624.1	5.03e-145	8	395	310	697
QHS23522.1	3.29e-143	29	394	343	708
AJG93766.1	3.31e-141	28	396	342	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	4.11e-119	32	396	350	716	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	4.55e-118	32	396	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.27e-117	32	396	350	716	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	6.21e-178	2	396	344	744	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	2.15e-160	23	394	20	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	4.91e-123	8	396	2	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	1.83e-118	32	396	350	716	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	3.63e-39	30	394	253	603	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002391_02365.