CAZyme Information: MGYG000002392_01375

Basic Information

• Species: Listeria monocytogenes
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes
• CAZyme ID: MGYG000002392_01375
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000002392_2|CGC15	40091.33	4.556

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002392	2941624	Isolate	not provided	not provided

• Gene Location: Start: 549742; End: 550770 Strand: +

Full Sequence      

MKWSEYANLAQLSLEKFYLADTKEQFLNNFYPTENPEEDNKVFNYWWLAHLVEVRLDAYL
RTKKQADLEIAENTYMHNKNRNGGTLIHDFYDDMLWNALAAYRLYKATGKPIYLEDAQLV
WQDLVDTGWNDIMGGGFAWRRPQMYYKNTPVNAPFIILSCWLYNELNETKYLEWAMKTYE
WQTKVLVREDGFVEDGINRLEDGAIDYEWKFTYNQGVYIGANLELYRITKEAKYLDTANK
TADISLKELTEDGIFKDEGSGGDEGLFKGIFYRYFTDLMEETANKTYRNFVFNSCQVLVD
NAKLDGYLLMGMNWKEKPSGKIPYSAELSGMIALEMAAKLER

Enzyme Prediction     

No EC number prediction in MGYG000002392_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	23	328	7.8e-87	0.8715083798882681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	0.0	1	341	1	353	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.06e-32	20	283	6	299	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	0.001	49	254	212	452	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam00759	Glyco_hydro_9	0.006	88	135	209	257	Glycosyl hydrolase family 9.
COG1331	YyaL	0.009	123	277	406	517	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY51238.1	3.29e-261	1	342	1	342
CDG44635.1	3.29e-261	1	342	1	342
AMD51478.1	3.29e-261	1	342	1	342
QOF60393.1	3.29e-261	1	342	1	342
AKI54806.1	3.29e-261	1	342	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	3.21e-246	2	341	2	341	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	2.76e-63	3	341	54	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	8.68e-62	3	341	55	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	6.75e-61	3	341	55	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	1.27e-25	44	286	37	282	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05031	1.66e-07	109	317	145	370	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002392_01375.