CAZyme Information: MGYG000002392_01665

Basic Information

• Species: Listeria monocytogenes
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes
• CAZyme ID: MGYG000002392_01665
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	MGYG000002392_3|CGC7	90492.41	6.5816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002392	2941624	Isolate	not provided	not provided

• Gene Location: Start: 222752; End: 225094 Strand: -

Full Sequence      

MSHLKDYTIGIQHIKQLTSEISLGTKLVFAISGQITIKDSEQKFYLQEGDILVLDRNTFY
TIEGNEANLFINLTISDTFFAHYYEDYFQHSFKFFSKESDPGRERVVGSLRKSVSELLIA
SATKKRANKLEAQSALFQILLLLTRFLKKGVPSSARKEVNDKRISRIIREVEERFDEALS
LRVFAQKEFLSEAYLSRYFKKTTGLGFLQYLTEVRLKHAIQDLLHSAESITEIALKNGFS
SQKHFSEVFKFHFELTPSEYRAEHHAETNLLIDNKASELGASIEQIVPSPEILVNLSRLY
HDVEPGKELNKAPFEKKKIDITEKTARCLSENMNILTIGELKEVLKANVQKQIITTRDEI
GINYIGIRHLFRGSTFLPETETDELVPTSSPYANADLALTFLKQQNLELFIRIEYQDIVG
DVAAVFERLDHFLKHCMQVFGREFVSKWHFMFFEPKNTYADKEELKKLYLKIYHIIKSRF
PAIQVGNFVPFSLSKNEVPERHMWFLDVADKIDFVAYNANQNEAVDFSKEDMKSFMISED
YCLSKTRKLKAFLKHYHINKPLMLVNWNTLTGNTRYTNGTFFRGALVLKTILDLAPEVDA
LGFWINTELHEGDDSQLNISLDGIEMFHFFDGKRPAFYAVKFLRRLKGVVVAEGADFIMT
KHTDGYQLILMNCANINPRYSVEERFTKEEQKELHIRITGLQAGEYQVCKWQFDRDNGAL
YSKYWQLNSKYGLDKEILDYIVDASQPTLTVSDETITEDWSFYAYLDINAIHFYEFRSTI

Enzyme Prediction     

No EC number prediction in MGYG000002392_01665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	430	725	2.1e-16	0.6937354988399071

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3664	XynB	1.58e-179	344	780	1	428	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	3.10e-28	143	266	1	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	3.71e-26	179	261	2	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	2.52e-23	185	262	2	80	Helix-turn-helix domain.
COG4977	GlxA	2.14e-22	151	263	209	321	Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQX73871.1	0.0	1	780	1	780
QOF59649.1	0.0	1	780	1	780
QUR88544.1	0.0	1	780	1	780
QGF42946.1	0.0	1	780	1	780
QOF64550.1	0.0	1	780	1	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OOU_A	1.56e-10	164	264	7	107	Thestructure of a protein with unkown function from Listeria innocua [Listeria innocua]
3OIO_A	2.14e-09	172	263	17	108	Crystalstructure of transcriptional regulator (AraC-type DNA-binding domain-containing proteins) from Chromobacterium violaceum [Chromobacterium violaceum]
1BL0_A	1.48e-08	155	261	4	110	MultipleAntibiotic Resistance Protein (Mara)DNA COMPLEX [Escherichia coli]
1XS9_A	1.58e-08	155	261	7	113	ChainA, Multiple antibiotic resistance protein marA [Escherichia coli]
3LSG_A	6.97e-08	176	261	17	102	Thecrystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_B The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_C The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_D The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_E The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GKK1	1.82e-80	5	777	3	740	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q8NYT6	1.76e-78	5	777	3	740	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q6GD21	1.76e-78	5	777	3	740	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q7A882	9.00e-78	5	777	3	740	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1
Q99XB1	9.00e-78	5	777	3	740	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002392_01665.