CAZyme Information: MGYG000002392_01991

Basic Information

• Species: Listeria monocytogenes
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes
• CAZyme ID: MGYG000002392_01991
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000002392_4|CGC2	37920.69	5.0181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002392	2941624	Isolate	not provided	not provided

• Gene Location: Start: 103174; End: 104232 Strand: -

Full Sequence      

MNGKQVMVGGLSLLLVGAGLGAFGSTAQAATDDASVMPDISNKQVLVGYWHSWKSSGKDG
YQQGTSADIALKDTPKAYNVVDVSFMKGDGVNRIPTFKPVGINDSDFRAQVGALNKEGRA
VLLALGGADGHVELKAGDEEAFANEIIRQVETYGFDGLDIDLEQSAITAGDNKTVIPAAL
KIVKDHYKAEGKNFLITMAPEFPYLKPGSAYESYLTSLANYYDYIAPQLYNQGGDGVWVD
ETNQWIAQNNDTLKESFLYYMADSFINGTRGYLKIPANKFVFGLPANVDAAATGYVTDPQ
IVKNVFTRLQAKGTPVKGIMTWSVNWDAGKNKAGVPYNNSFSNAYGPIVGTK

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	44	293	5.8e-29	0.6756756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3469	Chi1	0.0	20	352	3	332	Chitinase [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	7.19e-106	44	347	1	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	3.80e-18	45	337	1	268	Glycosyl hydrolases family 18.
smart00636	Glyco_18	5.95e-12	45	337	1	293	Glyco_18 domain.
cd00598	GH18_chitinase-like	2.10e-11	46	231	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKI49877.1	4.16e-260	1	352	1	352
AEO26230.1	4.16e-260	1	352	1	352
CBY55284.1	4.16e-260	1	352	1	352
ANE39821.1	4.16e-260	1	352	1	352
AKI41372.1	4.16e-260	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AXN_A	3.34e-153	30	349	11	327	Hallmarksof processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens],4AXN_B Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens]
3IAN_A	6.13e-140	40	349	1	310	ChainA, Chitinase [Lactococcus lactis subsp. lactis]
4W5Z_A	9.03e-126	45	349	32	338	Highresolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina. [Moritella marina]
4HMC_A	3.27e-123	45	349	10	316	Crystalstructure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	9.25e-123	45	349	10	316	Crystalstructure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S2	5.68e-161	14	349	12	347	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1
P27050	5.42e-33	20	349	166	511	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
A5FB63	6.67e-21	19	328	1118	1463	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
Q8NJQ5	3.40e-19	44	331	38	331	Endochitinase 37 OS=Trichoderma harzianum OX=5544 GN=chit37 PE=1 SV=1
E9F7R6	1.12e-17	44	330	41	333	Endochitinase 4 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000429	0.998742	0.000225	0.000233	0.000184	0.000148

TMHMM  Annotations     

start	end
7	29