CAZyme Information: MGYG000002394_00833

Basic Information

• Species: Prevotella rara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella rara
• CAZyme ID: MGYG000002394_00833
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		63914.86	5.7033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002394	3788330	Isolate	Russia	Europe

• Gene Location: Start: 158768; End: 160495 Strand: -

Full Sequence      

MAAVTGLCAQQAMAQYPQITPEAKAKFEAQRAEWEAHSDSAWQVAFPIVKKEAMEGRPYV
PWAWRPYDLKQAKIPAFPGAEGGGMYTAGGRGGKVLVVTNLNDDGPGSFRWACEQGGARI
IVFNVCGIINLKTPIILRAPYVTIAGQTAPGDGVCIAGESFQVNTHDVIVRHMRFRRGNT
HVWNREDSFGGNPVGNIMIDHCSCEWGLDENISFYRHMFDMGDGKPSRKEPTVNVTIQNT
ISAKALDTYNHAFGSTIGGENTTFMRNLWADNTGRNPSIGWGGVFNFVNNIVYNWVHRTA
DGGEFSTMSNFINNYYKPGPLTPKDSPIGYRIVKTESRSKNLFPYQQFGRVYAIGNIMEG
NEAVTKDNWDGGIQIADKDLKGEGGIPEDVMALMKSNEPFPMAHMTIIPSEKTFDYVLEN
VGATLPIRDIVDQRIIEEVRTGKAYYVKKLPKENPYGDMWGLSDKSKNEDGFFKYRRLDK
DSYKYGIITDPAQMGGYPEYKGEPRVDTDGDGMPDEWEIANGLNPNDPSDANGDCTGDGY
TNIEKYINGISTKVKVDWTDLKNNHDTLAGKTKLF

Enzyme Prediction     

No EC number prediction in MGYG000002394_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	127	316	1.2e-63	0.9890710382513661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18884	TSP3_bac	5.40e-05	507	528	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	1.08e-04	128	295	3	166	Amb_all domain.
COG3866	PelB	2.89e-04	87	330	48	291	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10099.1	0.0	12	571	29	584
QNT66944.1	0.0	14	574	22	580
BCS84828.1	0.0	12	574	19	577
QUT77855.1	5.96e-306	13	574	21	574
QUT92137.1	1.62e-303	12	574	20	574

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WL88	3.95e-50	74	550	21	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	5.49e-50	74	550	21	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
B8NQQ7	1.43e-49	74	550	20	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q0CLG7	3.83e-49	76	550	22	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	7.54e-49	74	550	21	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.673135	0.321186	0.003030	0.001341	0.000581	0.000712

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002394_00833.