CAZyme Information: MGYG000002394_02638

Basic Information

• Species: Prevotella rara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella rara
• CAZyme ID: MGYG000002394_02638
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000002394_30|CGC1	36478.48	7.9057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002394	3788330	Isolate	Russia	Europe

• Gene Location: Start: 11746; End: 12723 Strand: -

Full Sequence      

MKKLFITIIAALAAFTANAANPYDNPDTLVVSRDGTGQFRTINEAVEVCRAFMEYHKVIY
VKKGVYKEKVIIPSWLTNIEVCGEDAENTIITYDDHANIRLEDTNKPMGTFRTYTVKVEG
NYITFKNITIENNAAKLGQAVALHTEGDHLVFVNCRLLGNQDTVYTGLANTRLYFKNCYI
EGTTDFIFGPSTAWFEGCTIHSKQNSYVTAASTPADVAFGYVFNRCKLTAAEGVTKVYLG
RPWRPYAFTLFMNCELGSHILPAGWHNWGKASNEKTARYMEYNNSGAGATTKERAPWSKQ
LTKKEAAKITVDNVFKMDNSWIPEI

Enzyme Prediction     

No EC number prediction in MGYG000002394_02638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	316	8.7e-103	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	7.31e-80	29	308	7	289	pectinesterase
pfam01095	Pectinesterase	9.50e-79	30	313	3	293	Pectinesterase.
PLN02682	PLN02682	1.00e-67	28	306	70	352	pectinesterase family protein
PLN02197	PLN02197	3.98e-64	28	324	276	579	pectinesterase
COG4677	PemB	6.80e-64	26	316	80	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	8.65e-178	1	325	1	325
QVJ81978.1	6.35e-177	1	323	1	322
ADE82952.1	6.35e-177	1	323	1	322
QJR97878.1	5.52e-170	12	324	5	319
AGB28242.1	5.99e-166	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.52e-45	29	322	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.10e-42	30	322	6	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.04e-40	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.65e-39	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.06e-27	32	325	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.16e-59	31	322	9	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	3.06e-56	28	324	272	575	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	9.14e-55	28	324	276	579	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	5.07e-54	28	324	259	562	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	4.61e-53	28	322	84	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999131	0.000167	0.000161	0.000152	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002394_02638.