CAZyme Information: MGYG000002395_01379

Basic Information

• Species: Bifidobacterium adolescentis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium adolescentis
• CAZyme ID: MGYG000002395_01379
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000002395_1|CGC19	45568.42	4.4497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002395	2173720	Isolate	China	Asia

• Gene Location: Start: 1594552; End: 1595760 Strand: -

Full Sequence      

MDLDYIKGVNLGNWLVLEKWMNPALFDGTTADDEYYLPTQLDPAVYEARIRTHRAEYINE
RDFATIKSWGLNSVRIPVPYFIFGDRAPFIGCIDELDKAFNWAEKYGLTILIDLHTAPMS
QNGFDNGGISGVCKWAQLPDEVEFVLSVLERLARRYGHRRALMGIEIINEPNTTTCWPMA
NVTERYKAVDPELAEGTGPIAFDWLKNFYITAYHRLRDADKGALPADKAVVFHDGFDIEQ
WKDFMRGPDGKLAPEFKNVVLDTHQYLMTAETMGCPQTAEGYDDFVRNTYAPMIAEMSEY
FPVIVGEWCLFNSVGCGVDTHGGQSVLNGEEGAQAETLTAEQKRSLYQGVAESQLAAWSK
GSGFYYWNYKLLTDTVNTPGWIGWDAWDLGRCIAQDWFPVQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	370	1.1e-141	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.52e-25	4	172	16	192	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.98e-06	56	177	22	139	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJE06352.1	0.0	1	402	1	402
QHB63254.1	0.0	1	402	1	402
QTL81279.1	1.76e-316	1	402	1	402
AII76760.1	2.75e-313	1	402	1	402
BAR04061.1	7.88e-313	1	402	1	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	8.68e-177	6	399	3	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	7.09e-176	6	399	3	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	5.02e-39	6	399	13	391	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	2.75e-37	2	266	5	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	5.90e-37	2	381	11	373	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	3.43e-50	6	401	42	405	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B8N151	3.17e-46	4	401	29	395	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	3.17e-46	4	401	29	395	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q5B5X8	1.68e-45	4	399	27	391	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
D4AJL7	5.53e-44	4	399	32	400	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002395_01379.