CAZyme Information: MGYG000002395_01468

Basic Information

• Species: Bifidobacterium adolescentis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium adolescentis
• CAZyme ID: MGYG000002395_01468
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000002395_1|CGC22	34938.17	6.9127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002395	2173720	Isolate	China	Asia

• Gene Location: Start: 1731707; End: 1732702 Strand: +

Full Sequence      

MASHKKHAQPTTFALPGKSQMVKIVATVAAVGLLATGGIVSHNLYATAEKSPAKQVTAYS
VTDSIEASRGNAREALSGDTSYVTVKINGKTRVVPGMHFTDVKSVLDAGDITLDTEDTVS
PSLDTKVNENTVIKIERAGASVEVSDTDIAFNTVKKETSSLPKGQEKVETEGANGVMETT
NLVTKSGGKVMSSNMISSFVKKAPTDKVILVGTGSSSTPSAAAASIGTTVPAGEMQQWAH
DYLLSSGYSEADFTATVYIISHESGWNVAATNPSSGAYGLPQALPGSKMVSAGADWATNY
QTQLKWFWGYCAQRYGSIQGAYTYWLAHHCY

Enzyme Prediction     

No EC number prediction in MGYG000002395_01468.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	1.31e-19	83	213	154	283	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	2.00e-18	141	213	2	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	8.41e-08	83	124	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd13925	RPF	2.76e-05	258	287	5	34	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJE06441.1	1.57e-233	1	331	1	331
AVT45802.1	1.57e-233	1	331	1	331
AZH71965.1	1.57e-233	1	331	1	331
AII76785.1	1.29e-232	1	331	1	331
BAF40131.1	1.83e-232	1	331	1	331

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.883160	0.097869	0.001087	0.000598	0.000353	0.016937

TMHMM  Annotations     

start	end
21	40