CAZyme Information: MGYG000002395_01506

Basic Information

• Species: Bifidobacterium adolescentis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium adolescentis
• CAZyme ID: MGYG000002395_01506
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1134	MGYG000002395_1|CGC23	120852.76	5.9469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002395	2173720	Isolate	China	Asia

• Gene Location: Start: 1771998; End: 1775402 Strand: -

Full Sequence      

MKQSATLARLSKKTVAFLAAATTLLAGLSLATAAPQQANAATRDSYADTIGNPTFEAARQ
KYGLPKDMKDGATLHAFEWSFKTIMENIPDIAKAGYTSIQTEPIVKIKDNRKLGTGNWYL
NWYYVYQPTDMSIGNYVVGSEDEFKEMCKLAHQYGLRIIVDSVSNHFTSDFDVIEGKWKN
KAYYHEDKQISDYNNREDCTQHKLSGLWDLNTQDDTVTEGMHDLLVQTVADGADGFRYDA
AKHIELSDEVFGGKQSHYWDTILQNGAQYQYGEVLEDANVREADYADLFNKSSVGGGGIT
DSSYGHEVRNAVQFKNLGASHFTSHSKVTEDKSVNWVESHDNFANGEANIPQELSDEWIK
YGWAGVTAQKNGMSLFFDRPYKDGGTYGTGGVGTYGNGSGPFTENSKLGDAGSDLWKDPE
VVAVNHFRNAMVGEASNVSNCGDDNCLMVERYAGSAAQDGMVVANANASDKNLAGTSTKL
ANGTYTDEVTSSTITVSGGKVTSGTVKGQSIAAFSNKTRSGKVSTAEAYPNKGTIPGESK
TITLRSYQSTNTTYSTSDGQSGSFKDGDTIEIGSKAKSDEVVTVTVKGTGADGETIKHTY
SYTKYGDPTYDPSDGTSSPCDKYCMEYMEKNGLDPDCYIDAKEPCHPRNVTVTAIKVSGD
TSMDLASAQSVQLKADVTTDPAGKRPSVTWTSSDTSVATVDSKGKVSGLKAGTVKITATA
GTNKKSDSITITITGMKPEVSNVIYATKPSGWSKIYAYVYNDTTSKNNGNWPGVEMTQLT
ADDSCAKAGAYKYEVPDLGEGKYRVIFTNGSGAQTPGASQPGIEFSGKVSWDGSSAALGA
VECETTIPVTSVSISGDGVSGGKLSLKSGASVQLTATVKPDDATDRKVTWTSSDSSVANV
MGTGVVTAGSKAGKATVTATAGGKSASVEVTVEAVGKQPMTVWYKPASSWTTVKVNWRLG
SANAKDATVSMSKACGGWYKYTIADTKGKQVRVTFTDGKAWDSLDGKGYWASGTVMSVSG
GKVSTTAPDCQASAQPMTVWYKPASSWTTVKVNWRLGSANAKDATVSMSKACGGWYKYTI
ADTKGKQVRVTFTDGKAWDSLDGKGYWASGDSMAVAGGQLITDVTPNCTVTNKQ

Enzyme Prediction     

No EC number prediction in MGYG000002395_01506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	79	347	5e-97	0.9924812030075187
CBM26	744	823	1.2e-23	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11315	AmyAc_bac1_AmyA	2.41e-153	70	438	1	352	Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes Firmicutes, Proteobacteria, Actinobacteria, and Cyanobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
cd11317	AmyAc_bac_euk_AmyA	1.15e-22	71	342	2	238	Alpha amylase catalytic domain found in bacterial and eukaryotic Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes AmyA proteins from bacteria, fungi, mammals, insects, mollusks, and nematodes. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
cd11320	AmyAc_AmyMalt_CGTase_like	1.91e-21	81	341	46	313	Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins. Enzymes such as amylases, cyclomaltodextrinase (CDase), and cyclodextrin glycosyltransferase (CGTase) degrade starch to smaller oligosaccharides by hydrolyzing the alpha-D-(1,4) linkages between glucose residues. In the case of CGTases, an additional cyclization reaction is catalyzed yielding mixtures of cyclic oligosaccharides which are referred to as alpha-, beta-, or gamma-cyclodextrins (CDs), consisting of six, seven, or eight glucose residues, respectively. CGTases are characterized depending on the major product of the cyclization reaction. Besides having similar catalytic site residues, amylases and CGTases contain carbohydrate binding domains that are distant from the active site and are implicated in attaching the enzyme to raw starch granules and in guiding the amylose chain into the active site. The maltogenic alpha-amylase from Bacillus is a five-domain structure, unlike most alpha-amylases, but similar to that of cyclodextrin glycosyltransferase. In addition to the A, B, and C domains, they have a domain D and a starch-binding domain E. Maltogenic amylase is an endo-acting amylase that has activity on cyclodextrins, terminally modified linear maltodextrins, and amylose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG0366	AmyA	2.59e-18	44	291	9	263	Glycosidase [Carbohydrate transport and metabolism].
cd00551	AmyAc_family	2.12e-17	64	364	6	240	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJE06469.1	0.0	1	1134	1	1134
AZH71983.1	0.0	1	1133	2	1219
QHB63355.1	0.0	1	1133	2	1222
AII77047.1	0.0	1	1134	1	1128
AXR42240.1	0.0	1	1134	2	1288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DC0_A	4.05e-94	68	514	3	419	Crystalstructure of native alpha-amylase from Bacillus sp. KR-8104 [Bacillus sp. KR-8104]
1UA7_A	3.84e-91	68	514	3	419	ChainA, Alpha-amylase [Bacillus subtilis]
1BAG_A	5.83e-91	68	514	6	422	ChainA, ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE [Bacillus subtilis]
1QHO_A	1.61e-12	51	550	22	525	FIVE-DOMAINALPHA-AMYLASE FROM BACILLUS STEAROTHERMOPHILUS, MALTOSE/ACARBOSE COMPLEX [Geobacillus stearothermophilus],1QHP_A Five-Domain Alpha-Amylase From Bacillus Stearothermophilus, Maltose Complex [Geobacillus stearothermophilus]
1VIW_A	5.53e-12	74	527	14	458	TENEBRIOMOLITOR ALPHA-AMYLASE-INHIBITOR COMPLEX [Tenebrio molitor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00691	1.39e-96	68	619	47	570	Alpha-amylase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyE PE=1 SV=2
P30269	7.15e-61	70	517	147	608	Alpha-amylase OS=Butyrivibrio fibrisolvens OX=831 GN=amyA PE=3 SV=1
P23671	3.96e-60	64	543	47	488	Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=amyA PE=3 SV=2
O76284	8.16e-17	74	342	34	311	Alpha-amylase-related protein OS=Drosophila bocqueti OX=74549 GN=Amyrel PE=3 SV=2
O77019	1.08e-16	74	342	34	311	Alpha-amylase-related protein OS=Drosophila bakoue OX=30018 GN=Amyrel PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.999007	0.000174	0.000213	0.000158	0.000134

TMHMM  Annotations     

start	end
13	35