CAZyme Information: MGYG000002396_00109

Basic Information

• Species: Bifidobacterium bifidum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium bifidum
• CAZyme ID: MGYG000002396_00109
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863		92246.44	5.4325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002396	2311342	Isolate	South Korea	Asia

• Gene Location: Start: 135046; End: 137637 Strand: -

Full Sequence      

MVSPHHLLKIATALSAVALTASVAVTPAYALQDIAIEDAVAQSGPVTADNGVVVQSDDQS
GDQQSQDSMPDNPNAKLPGTVSDEISDDATVVSEDLAVTPEGEVKNIETGETVTDATLVG
TQDQQPDPLAKTNGESFIPVSAEDVKNAVADANVQLSKFEGNEYGAHWGTYNNTKAFFDY
QNNLFVQQAKGVIDVSEWQGDIDWAKAKADGVEGVIIRLGYGWGNNADRKAQRNISECKR
FGIPFGIYWYSYADTPSIAKEEGAGAVAKLKRFGVRASDLAYPVYYDLEKWTWKGHQPPT
DPNVYNDIVNNWYGALQSAGYKNLGVYSYTSYLQGPLKHADIYAKTTWVAQYGARMGFDS
FPTNSRGWQYTSSGKVDGISGNVDMNAFGNKEYVNGGSSNDLQAAIDVRKMTAVTIPNGN
YYINVRSKVASSVDIPGGSAADSTAIQLYSGNSSKAQQFAFTRQSDGSYEIVNVNSGKAL
DVRNGVAENNAIAQQYSRNNSQAQRWFIRDSGAGYYLQSALGNWVLDLSGGNTANGAAIR
LYAPNGTAPQLFVVSSSDVNIATGVSMIITSVANKKLVTDVTGASTANGARVQLYSSNNT
NAQKYRFESIGNGTYKIINANSGKVLDVSGGSTANGAALQQYTSNNTVAQQWTMRNYGSG
RIALVSVNANKAVDIPGGNAVQQAQLQLYSPNGTAAQQWTVAKAPLTLRERLNETAAKHR
QDLPDGTYTFGSRLNTSMKMDVSGASRSNYGNVQIWANNGTNAQKWKVTHDSNGYATLTS
VNSGKVLDVNGGVSASGTNVQQYDSNGTYAQKWIAVKNSDGSYTFQSALAENIVLDVSGA
STSNGANVQLYTANGTNAQKWVK

Enzyme Prediction     

No EC number prediction in MGYG000002396_00109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	193	379	6.7e-37	0.9943502824858758
CBM13	660	817	1.4e-26	0.6914893617021277
CBM13	516	654	3.5e-26	0.6648936170212766
CBM13	431	579	6.7e-23	0.7446808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	5.79e-69	190	388	1	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.68e-28	192	388	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam14200	RicinB_lectin_2	2.46e-24	762	851	1	89	Ricin-type beta-trefoil lectin domain-like.
cd06523	GH25_PlyB-like	9.26e-24	192	387	2	176	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam14200	RicinB_lectin_2	7.77e-23	601	699	1	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXM90834.1	0.0	1	834	1	834
ALE10489.1	0.0	1	832	1	836
VEG16747.1	0.0	1	832	1	836
ADP35190.1	0.0	1	832	1	836
QGM63437.1	0.0	1	834	1	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	1.16e-38	160	388	238	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	2.85e-38	160	388	238	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRT_A	6.47e-11	193	444	23	253	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRU_A	1.36e-10	193	400	23	219	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
3HMC_A	4.47e-10	192	391	7	183	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	5.82e-11	193	428	12	226	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
Q8X7H0	3.54e-06	193	412	70	271	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	7.37e-06	193	388	85	279	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P34020	8.70e-06	193	396	4	188	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998895	0.000223	0.000198	0.000182	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002396_00109.