CAZyme Information: MGYG000002396_01710

Basic Information

• Species: Bifidobacterium bifidum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium bifidum
• CAZyme ID: MGYG000002396_01710
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154		17200.25	10.3515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002396	2311342	Isolate	South Korea	Asia

• Gene Location: Start: 2016705; End: 2017169 Strand: -

Full Sequence      

MHSRPMFPILETQVGGGWVGDVDYTKQATKQDSNFLVDWVRVYQSEGQPVTRFDDLDGAE
SGAYRIAPASRTEGLTAVSNGDAAWQNKNNFYYGGQPRYETSRSHAVPLMQGRFALRLRG
PQTLCRIRANAFTRSERPVAGKVVPPNRRNRAAP

Enzyme Prediction     

EC	3.2.1.23	3.2.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	6.13e-07	4	43	199	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXM92485.1	7.80e-112	1	154	1	154
QRI57532.1	7.80e-112	1	154	1	154
BBA56534.1	1.77e-108	1	154	1	154
ALE10858.1	9.62e-107	1	154	15	168
QTQ17841.1	2.42e-106	1	154	1	154

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002396_01710.