CAZyme Information: MGYG000002397_01513

Basic Information

• Species: Bifidobacterium angulatum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium angulatum
• CAZyme ID: MGYG000002397_01513
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002397_7|CGC1	32987.29	6.0746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002397	2046632	Isolate	Russia	Europe

• Gene Location: Start: 35168; End: 36058 Strand: -

Full Sequence      

MLDLANPAAYRHVHDQMAALIGQLGIDYIKWDHNRDVTEPVHDGQYGLHEQTLACYRLFD
DLKREFPGLKIESCSSGGARTDAGILQHADRIWGSDSNDPRDRVDIQRYTELVVPPEMIG
AHVGPSPAHSTWRATDLSYRAAISLEGCSGFEWNILECSDQELASLKAFVALYKELRGLL
HTGRVQHADFIDPALRGRGVVSADGSHAVWVVAATTNLRDALAERLHVRGLDPSRTYRVR
LRDEVGEPRWGWNTPQWIAAARNGGFEAPGSLLEQIGLQMPPLWPMQAVILEIKAM

Enzyme Prediction     

No EC number prediction in MGYG000002397_01513.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	1	243	1.8e-87	0.36046511627906974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	3.35e-66	2	183	160	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	4.87e-54	1	175	120	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	3.49e-48	2	245	411	654	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam16874	Glyco_hydro_36C	4.39e-06	200	293	6	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG22793.1	1.80e-186	1	296	435	730
ADB08818.1	1.80e-186	1	296	435	730
BAQ26118.1	1.80e-186	1	296	435	730
QTL79862.1	8.30e-185	1	296	435	730
AZN74055.1	1.52e-175	1	296	438	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	3.01e-32	1	239	447	692	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	3.50e-31	1	239	447	692	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6PHU_A	3.55e-31	1	245	461	710	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6JHP_A	3.62e-31	1	239	488	724	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
4FNT_A	1.62e-30	1	239	447	692	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16551	9.67e-52	1	294	410	705	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
Q0CVH2	1.43e-34	1	281	476	732	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1
Q92457	1.07e-32	1	239	473	711	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1
Q5AU92	2.31e-31	1	239	480	716	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
B8NWY6	7.86e-31	1	239	479	717	Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002397_01513.