CAZyme Information: MGYG000002398_00726

Basic Information

• Species: Laribacter hongkongensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Aquaspirillaceae; Laribacter; Laribacter hongkongensis
• CAZyme ID: MGYG000002398_00726
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000002398_1|CGC4	24431.96	10.0382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002398	3424272	Isolate	China	Asia

• Gene Location: Start: 748946; End: 749620 Strand: -

Full Sequence      

MNLKRFLWHTLSALTLTATVAAFQPAMAAMYGYIDNDGRVHISSSKLDPRYQPIPPGQTL
QPAKKTPSLVALKPAKPVEAHPARVGRYRDLVEQVADKYDLNPDLMHAIISVESGYNPKA
VSNRGARGLMQLMPATGKRFGGRQLSDPKQNLEAGARYLAYLLDKFDNRLTLAIAAYNAG
EGAVQRYGTVPPYKETRNYVAKVMATYVAASSDDTPSLGSSMSS

Enzyme Prediction     

No EC number prediction in MGYG000002398_00726.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	101	214	1.4e-37	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.56e-49	103	207	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	3.17e-49	87	207	3	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.92e-48	88	208	6	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	3.83e-34	92	209	1	158	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	7.11e-33	96	199	5	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASJ23579.1	3.04e-157	1	224	1	224
ACO73748.1	5.04e-156	1	224	1	224
AVY92988.1	2.77e-93	1	214	1	217
BAK78649.1	1.33e-52	26	207	12	217
QBJ80253.1	1.34e-52	28	207	14	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.84e-14	85	210	413	557	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.85e-14	85	210	417	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.86e-14	85	210	423	567	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.87e-14	85	210	427	571	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.88e-14	85	210	433	577	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.50e-38	57	209	27	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	9.04e-34	86	220	1420	1554	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	9.04e-34	86	220	1420	1554	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P39434	3.54e-14	88	205	480	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
A8ZWR8	7.56e-14	84	185	282	389	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001244	0.997598	0.000447	0.000278	0.000208	0.000187

TMHMM  Annotations     

start	end
7	29