CAZyme Information: MGYG000002398_01530

Basic Information

• Species: Laribacter hongkongensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Aquaspirillaceae; Laribacter; Laribacter hongkongensis
• CAZyme ID: MGYG000002398_01530
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202	MGYG000002398_1|CGC7	22039.01	9.4442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002398	3424272	Isolate	China	Asia

• Gene Location: Start: 1552832; End: 1553440 Strand: +

Full Sequence      

MQKRNMKQILTGLTLSVTISGCVSTGPGGQTGIHAETAALVAGTALATAVMMNAANTETQ
VVTYPSYPERFDRPVHAGRGGQIETGRRGLCLDISRQVVNGAPLQIWNCNGRVNQRFRRV
GEEIRIDGKCLDVAGLNQQDGARVIAYTCNGGENQRWDVSGGMIRSRMNGKCLDVSGERF
EQGTPVVMWRCHGGRNQRFSWQ

Enzyme Prediction     

No EC number prediction in MGYG000002398_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	127	201	3.3e-23	0.4095744680851064

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	4.79e-45	28	199	67	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam00652	Ricin_B_lectin	3.34e-25	81	199	3	126	Ricin-type beta-trefoil lectin domain.
cd00161	RICIN	4.15e-21	86	201	7	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
smart00458	RICIN	1.88e-18	86	202	4	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
NF035929	lectin_1	5.91e-18	11	200	632	835	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASJ24435.1	1.87e-114	6	168	1	163
ACO74321.1	1.08e-113	6	168	1	163
QPS82502.1	7.44e-19	64	167	143	245
QRI88007.1	7.44e-19	64	167	143	245
AOV00757.1	1.03e-18	64	167	143	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56030	4.67e-07	89	167	62	138	Probable lipoprotein EnvE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=envE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002398_01530.