CAZyme Information: MGYG000002398_03079

Basic Information

• Species: Laribacter hongkongensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Aquaspirillaceae; Laribacter; Laribacter hongkongensis
• CAZyme ID: MGYG000002398_03079
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000002398_1|CGC16	36120.78	8.5053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002398	3424272	Isolate	China	Asia

• Gene Location: Start: 3174809; End: 3175852 Strand: -

Full Sequence      

MTGGTGGHIFPALAVADELRQRGWTVVFLGAEGGMETRLVPDRGYPLKTLAIRGVRGNGV
RRWLLMPLMLARAVLKSLALQFGVRPDVVVGFGGYTGAPGGLAARLLWKPLVIHEQNSVA
GLTNRVLSHIATRTLFAFPGAFAGKAGLVGNPVRADIAALPAPESRFAGRSGPLRLLVVG
GSLGARVFNEVVPEALARLPAAERPVVVQQAGAKQLDALRDNYARAGVTADCRAFIDDMA
AEYAAADLVLCRAGALTVAELAAAGVASVLVPFPHAVDDHQTGNAAFLADAGAGILLPQS
GLTAESLAALLADMTRDRCLEMAVAARRQARTDAASRVADVCEELAE

Enzyme Prediction     

No EC number prediction in MGYG000002398_03079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	176	334	3.9e-48	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.17e-162	1	347	7	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.21e-140	1	341	5	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	9.78e-128	1	342	6	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	6.17e-122	1	347	6	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	2.89e-43	176	338	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASJ26073.1	5.90e-241	1	347	8	354
ACO76033.1	2.80e-239	1	347	8	354
AVY95975.1	4.43e-183	1	346	3	348
BAK75021.1	1.48e-173	1	345	3	347
AQR66858.1	6.38e-170	1	347	3	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.80e-92	1	346	8	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	6.70e-90	1	346	12	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	1.96e-89	1	345	15	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5P6Z6	5.67e-133	1	346	7	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=murG PE=3 SV=1
Q8XVI7	4.27e-132	1	342	16	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=murG PE=3 SV=1
A1K3U6	2.76e-128	1	347	7	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Azoarcus sp. (strain BH72) OX=418699 GN=murG PE=3 SV=1
Q1LIM6	2.10e-125	1	346	9	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=murG PE=3 SV=1
A1TKD1	8.19e-125	1	345	10	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acidovorax citrulli (strain AAC00-1) OX=397945 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999739	0.000231	0.000031	0.000001	0.000000	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002398_03079.