CAZyme Information: MGYG000002400_00152

Basic Information

• Species: Staphylococcus lugdunensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus lugdunensis
• CAZyme ID: MGYG000002400_00152
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000002400_8|CGC1	34710.1	9.9092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002400	2523999	Isolate	not provided	not provided

• Gene Location: Start: 7086; End: 8000 Strand: -

Full Sequence      

MIKKFVAYMQQASYLKYETKYKLIKHILITMFALLCLILLILFIASMFYFHRITSHASAM
SDNELKKKAIHFAGDEAIDHKNSNILQAYDQSQNTLIVGPKRVNSNVIAALTSSEDTLFY
QHNGILPKALIRAMIQDVFNVKQSSGGSTITQQLIKNQVLSSEKTYRRKANELVLSLRLE
KILTKDEIVYTYLNVVPFGRDYNGSNITGIASASYSLFGIPPSKLNIAESAYLIGLLQSP
YTYTPYDEDGSIKNNNQFNIGIQRQHYVLKRMRVENKISVKDYHKALNFDIKHHLLQRDK
QDAS

Enzyme Prediction     

No EC number prediction in MGYG000002400_00152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	86	272	1.5e-51	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.81e-64	79	292	60	260	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.04e-64	93	273	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.11e-50	105	304	12	197	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.16e-48	92	288	64	246	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.22e-31	102	288	65	236	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG60435.1	2.84e-211	1	304	1	304
BBN85190.1	2.84e-211	1	304	1	304
ATN13925.1	2.84e-211	1	304	1	304
QHP97061.1	2.84e-211	1	304	1	304
QRF17555.1	2.84e-211	1	304	1	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JE5_A	8.12e-44	78	296	37	255	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3NB6_A	3.68e-26	93	288	18	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.00e-25	93	288	18	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	1.22e-25	81	291	26	247	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	1.34e-25	81	302	13	220	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	5.07e-27	92	287	73	263	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	5.08e-27	92	287	73	263	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	5.08e-27	92	287	73	263	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
Q891X1	2.26e-26	79	289	65	268	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
Q97GR5	2.58e-25	82	304	80	301	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	50