CAZyme Information: MGYG000002401_00196

Basic Information

• Species: Propionibacterium freudenreichii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Propionibacterium; Propionibacterium freudenreichii
• CAZyme ID: MGYG000002401_00196
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	MGYG000002401_1|CGC5	85842.62	4.9142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002401	2630908	Isolate	United States	North America

• Gene Location: Start: 235074; End: 237473 Strand: +

Full Sequence      

MPGQPARAASVPESEQRRQAHQIVSRLAPDEKAALLSGADAWHTVGLGRLDVAAVTLADG
PAGLRKVTDPEVGVMRFDNAVRATAFPVPAALGNSFDPDVVAMVGRAIGEEAREQSVGVV
LGPGINIKRSPLGGRNFEYYSEDPILSGQLGAAWVQGLQSCGVGACVKHFAANNQETRRM
TADALIDEQTLYEVYLRAFEHVVRTADPWTLMCAYNRVNGTYCSESHWLLTELLRDQWGF
DGLVVSDWGAVLDRVRSLAAGVDLAMPPDLAHDAADIQSAIARGMLSPQGRDEACARVVE
LALKVTQGTTRELGRRVGAHHHVAREAAGRSIVLLRNRAVDANNHGSANPVLPLAHGAKL
AVIGEFAANPRFRGGGSSQVIPMLLDIPLDEIRGRADEPVRYEAGFLLSGESDDELADRA
VEAAEEAEVAVVFVGLPDDAESEGLDRTSILLPAVQTGLVQRIAAANPRTVVVLTNGGVV
QLAEWSSEVPALVEASLLGEAGGSAIADMLFGEVNPSGRLAETIPLRLQDTAAYFNFPGD
RDQVRYAEGLHVGYKWYNASQLEVAYPFGHGLSYTRFSYNGLHLAADESGLHARFTLRNT
GARVGREIPQLYVALRTSAYRRAGFEFKASAVVQLAPGEQREVTLSVPPADLGVWDADLH
RWLVEGGDYDVAVGASSRDIRLNGIVTVRGEARPRTLDRDSTVSEWLSSPLMAQFLAVQL
ANLATDPGAASDGAGPRDPQEFMSLAHDLRLSQLPVLAPQLHISREQIDQLIAAAGMDAR
PRPRRIDDSDVEGPDVSPR

Enzyme Prediction     

No EC number prediction in MGYG000002401_00196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	49	267	6.7e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.15e-69	84	681	118	758	beta-glucosidase BglX.
COG1472	BglX	5.73e-56	69	379	67	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.14e-49	18	579	51	638	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.86e-48	332	574	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.61e-35	11	301	11	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL55785.1	0.0	1	799	1	799
CUW06218.1	0.0	1	799	1	799
CEP26308.1	0.0	1	799	1	799
AJQ89980.1	0.0	1	799	1	799
ARO13043.1	0.0	23	799	1	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.93e-186	22	695	7	675	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.73e-185	24	717	9	692	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.83e-122	21	693	5	718	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.76e-121	21	693	5	718	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	7.33e-90	22	680	8	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	2.70e-185	22	695	7	675	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	9.98e-177	24	757	9	736	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	7.89e-176	24	721	9	705	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.14e-114	24	687	50	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	2.52e-105	23	681	5	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991386	0.008571	0.000028	0.000016	0.000009	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002401_00196.