CAZyme Information: MGYG000002401_01453

Basic Information

• Species: Propionibacterium freudenreichii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Propionibacterium; Propionibacterium freudenreichii
• CAZyme ID: MGYG000002401_01453
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000002401_1|CGC12	38059.93	9.4536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002401	2630908	Isolate	United States	North America

• Gene Location: Start: 1596569; End: 1597669 Strand: -

Full Sequence      

MVNVVLAGGGTAGHTSPLIATAEQLAMADPGGSLVCVGTAKGLETRVIPEAGLRLELIPP
VPLPRHVNADLFKVPTRLVGAVRAASRILRTAHADVVIGFGGYVSMPVYLAARRMHVPVV
VHEQNALPGLANRIAARFAAAVLTTFPDTRLPHAQRVGLPVRDAIAELAEQGRSARRGPA
RDSFGLRRDLPVLLVSGGSSGARSINRATVAARDQLLAAGVQVLHVLGLKNFHDDKPVTD
QQTGAGYHPVAYVDDMASAYAAADLMLARSGAGTVVETAVVGLPAIMVPLPIGNGEQARN
AAPLVGADAGIIVPDDELGPQRLIREVVPLINDADRLSTMGEAAQRVMPAGAAQRVANVV
LQEASR

Enzyme Prediction     

No EC number prediction in MGYG000002401_01453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	193	347	7.7e-46	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.56e-126	1	366	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.43e-110	4	359	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.13e-95	4	360	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	3.69e-91	4	366	3	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	2.34e-38	1	301	1	293	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJQ91178.1	5.65e-256	1	366	1	366
AWY95429.1	5.65e-256	1	366	1	366
CBL57048.1	5.65e-256	1	366	1	366
ARO13215.1	5.65e-256	1	366	1	366
CEP27474.1	5.65e-256	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	4.72e-48	4	360	9	350	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	2.07e-45	3	364	4	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.00e-37	3	360	11	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6A9Q2	1.14e-143	1	365	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=murG PE=3 SV=1
A1SL80	1.31e-123	2	362	1	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=murG PE=3 SV=1
A1R5F8	4.24e-111	2	365	12	371	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=murG PE=3 SV=1
Q73YQ8	1.75e-108	2	361	32	391	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) OX=262316 GN=murG PE=3 SV=1
A3Q1L8	1.85e-107	2	364	5	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycobacterium sp. (strain JLS) OX=164757 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002401_01453.