CAZyme Information: MGYG000002403_00886

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_00886
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1746	MGYG000002403_25|CGC1	191523.07	4.9313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 8422; End: 13662 Strand: -

Full Sequence      

MKWKKVLSVLLSAAMIMGTVSPGLEVRAAEDAVSNVADINSSIEDNYAEEAGSDAENENS
SEQETNGDATEVDRIGKEILDVQEDDSIGKENGIAQEEDNTGKESGDVKEQGKIVYYDFQ
SYDSTIINDASGNGKAGVVRNYDAGGFRIIDTNIYGKDVKALSLPGGSDGGYLELPVGLL
DGEESVTISTWVKLLTDTGYQRIWDLGSGTSSYMYLLSDGANDGFKGYSAAITTGGWSRE
QGVSKGSNVDKNRWVLTTVVIDGTNMSLYENGSLVETKDTGISLKDMGHTTQNYIGYGQF
GDDPTNAQYAEFEIYNYAMNAEQVAAMYDVDDTGIVNGDAAALNLGDLTAVTADLSLPAA
GENGSVIEWTSSDPAVIANDGKVVRPAAGEPDAQVTLTATVKYQEASATKEFRAVVPAML
GDKAIVAQDLAEINLVDLDSVVSNLQLPTEGKNGSVITWESSRPDVIANDGKVIRPAAGQ
PDVEVLLTASASFKTASGNKVFNATVLAEDEEVTITNYEPVSVTTKAGNVPSLPDSIKVT
YSNGKTGKVKTVWNTPDKGDYAQPGKFEVKGRLLGTKQVIKAEVTVVEQLDSDIVLQAEG
FDLNDITLDGDSILTQNRSRTLEYLKLLDNDRMLYNFRKTFGADTKGAAPLGGWDEPTGL
LRGHSTGHYLSALSLAYASTKDAEIKEKLDEMIHELRSLQMLSQGDPAAFKTKGTDQKVW
NTNPREWGEGFISAYSPDQFALLEQYTPYATIWAPYYTLHKIIAGFLDAYTYAGNEEALE
AAKALGKWVYQRLSACSQEQLTKMWDMYIAGELGGFNESMAKLYELTGDEDYLKGARLFD
NTKFFDNLSKNVDDIQGRHANQHIPQIIGAMEVYQATVQAGQEEPYYFHVASNFWDMVVS
RYAYSIGGVGTGENFKEPYKQAEYINGDRNCETCAAYNMLKLTKMLYQYDADNAKYMDYY
ERTLYNQIIASQNPNVTEKMHNGTTYMLPIGPGVRKDYGGDYDSFTCCHGTGMENHVKYQ
EAAYYQDDTTMYVNLYLPSSVTWQEKGVTVTQDTEFPSEVTTLTVAKTQGQTASEFDMKL
RVPYWAEQGFEVTVNGNKQIEQAEPSSYVTLNGVKAGDVIMIRTPYGYHLDKTPDQLSGA
DVASLMYGPFVMVAKSDSSKWKTLVLSNVLDRSIKKVEEEKVPTLVTNGLTFRPMYDASD
YAYHTYFKIMSGEGSGAYYEVNISNSTPERGSFEVNSELVKEGSDLIITAKPNEGYKVKK
LMVDGQLVTIGADNTYTVKNVQKNTEISGSFALINPPAQDNSAVEQTATVSAHFTAGWEN
LNGIKNQKFNPAVSNGGMGKGWGNWPQSKGAQCWVEYEWDAPVTINGSSIFWYDDGADTR
VPGEIKFQYEDENGSVQEAVLTSDPGKAKNIDQYNPFTFNTFTTTRLRLQMTVADNAAAI
GIYRWVVTYEDNEKPVVDTAKLAEAIAKAEAMDTKAYTDASAAELKRVIEEVKGLLSKED
ITVEQVEEGCKKLENAVNGLVLKPVVKPVDKSRLVSLVSACSKEKQDNYTKASWDQFIKA
LNSAKVILGKANASQQEVDNILKTLTSSKDQLVKIKIVFTKKLTIGKKEKIKLSASGYTF
SIKKGKGVVTVNKKGQVQGKKTGKAVIHAVSKSGKMKIWNITVKKAPSKIVKLNKKSVTI
KKGKKFTIKVTLPKNTASYRYTFKTTNKKIASVSSSGVIKAKRKGSCKIWVYTFNGKKKE
IRVQVK

Enzyme Prediction     

No EC number prediction in MGYG000002403_00886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	611	1152	5e-180	0.9860834990059643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.68e-130	605	1151	1	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.86e-70	610	1200	15	543	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam13385	Laminin_G_3	1.23e-21	166	325	2	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam07532	Big_4	4.54e-10	519	576	2	59	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
pfam07554	FIVAR	0.001	1548	1593	21	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF45278.1	0.0	110	1456	38	1387
AWI04506.1	1.68e-275	114	1207	61	1211
AKA69367.1	2.15e-272	114	1207	61	1211
AET60941.1	9.46e-172	427	1209	13	765
ASR47498.1	5.44e-171	423	1209	14	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.80e-82	597	1193	24	603	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.77e-77	597	1193	24	603	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.45e-14	819	1151	197	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.91e-14	819	1151	197	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5HO0_A	4.87e-11	422	518	552	648	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A3R0A696	8.70e-16	215	501	161	453	Alpha-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=blArafA PE=1 SV=1
E8MGH9	3.98e-11	1340	1568	1529	1776	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999029	0.000207	0.000168	0.000168	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_00886.