CAZyme Information: MGYG000002403_01384

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_01384
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000002403_46|CGC3	66364.64	4.9887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 61882; End: 63618 Strand: -

Full Sequence      

MEHAVKINLSHIPFSRYGAYLSLSADFASSKLMIHNVSKSFGEDVMYEVMFSRDGMEVPV
EITADPAVVLVSSKEWRVRFYIRDDEELAVESEGLDLTFRQQNQYGYGIAEGSKIHIINI
HQHLYTMCQIEKGQGVLLSQPRYEKGGETGVKQNFKICCKDEKILAVIRISDQEKRSLNL
PVNPEEDIAGIQKEWEDFKNKMQDISEERKAYCEITWFNLWSSFVRARGNYAYDTMLMSK
KSMCAVWSWDHCFNALVLAESDPKAAIEQFLLPFLLQAENGCLPDMWRPNGEIVWCISKP
PIHGWCFSKLMDKMDIPKNVLKEVYHYLSSWTNWWMEYRDYDRDGIPAYPMGCDCGWDNA
TVFDGGYFVETPDLPAFLILQMKCLARIAAALEDQDGTRHWEEQAKGLLYSLYEHSYENG
RFVSMRDGSHEQLPEDHCLLNCMPLVLGDILSQKERACISQILEAEFLTMWGPATEAKCS
KKYESDGYWRGPIWAPSTYLLADGLNRGGNEALAKKIATGFCEMVEKQAKGNYENFDAVT
GKGLRAPGYTWTASVYFMFVREFLEKKDKKEGQRDGEI

Enzyme Prediction     

No EC number prediction in MGYG000002403_01384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	199	564	3.6e-43	0.45087719298245615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	9.12e-15	245	560	283	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	9.22e-06	170	566	264	786	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	1.66e-05	488	555	408	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	1.55e-04	494	563	428	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63144.1	4.53e-108	5	564	1	569
ABV33853.1	1.63e-104	5	569	1	567
ATF16357.1	5.43e-104	5	564	1	563
QDS37001.1	2.13e-103	5	564	1	563
AEE95252.1	4.47e-103	5	564	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.71e-08	164	567	231	760	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
4WVA_A	4.35e-08	247	561	32	420	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3W7X_A	1.47e-07	164	567	231	760	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.94e-07	164	567	231	760	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
7Q6Z_B	3.22e-06	164	454	579	900	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	3.34e-10	247	555	98	480	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.03e-09	247	555	98	480	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	2.06e-07	164	567	254	783	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_01384.